RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G074420
Reference: TK1151 Chr: Chr06 Coordinates: 19920756-19921144 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

321 bp · TkA06G074420|TK1151|cDNA

TTTCTTTTAGAGTGTGGGCACCTTTTCACTTGTGGGGACGGGTCGTTCGGTCAGCTCTGGCAGGGGGATTACACGTCACAAAGCTGCCCGAAAAAAGTCGCGTGTTTTTCATCCAGACATGTTGAGCAAATTGCATGTGGGATGCGTCATTCACTAGCCTTGGTAAAGGGTGAATATGGAGACCAAGTGTTTGGTTTTGGGTCTGGAAAACGTGGTCAACTAGGAATATCTGATAAAGTCAAATCAATAAATATTCCACA...

CDS

Download CDS FASTA

321 bp · TkA06G074420|TK1151|CDS

TTTCTTTTAGAGTGTGGGCACCTTTTCACTTGTGGGGACGGGTCGTTCGGTCAGCTCTGGCAGGGGGATTACACGTCACAAAGCTGCCCGAAAAAAGTCGCGTGTTTTTCATCCAGACATGTTGAGCAAATTGCATGTGGGATGCGTCATTCACTAGCCTTGGTAAAGGGTGAATATGGAGACCAAGTGTTTGGTTTTGGGTCTGGAAAACGTGGTCAACTAGGAATATCTGATAAAGTCAAATCAATAAATATTCCACA...

Protein

Download Protein FASTA

107 aa · TkA06G074420|TK1151|PROTEIN

FLLECGHLFTCGDGSFGQLWQGDYTSQSCPKKVACFSSRHVEQIACGMRHSLALVKGEYGDQVFGFGSGKRGQLGISDKVKSINIPQSVTGLKEVDVSSIIANGDHS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G074420
TK1151 IDTkA06G074420
OH-1004 IDLXL04_030647
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)38.200
Protein coverage (%)TK1151 69.159 / OH-1004 8.858
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G074420
LocationChr06:19920756-19921144 (-)
DescriptionSimilar to PRAF1: PH, RCC1 and FYVE domains-containing protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030647 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006281 DNA repair Biological Process
GO:0006974 DNA damage response Biological Process
GO:0007283 spermatogenesis Biological Process
GO:0009411 response to UV Biological Process
GO:0009649 entrainment of circadian clock Biological Process
GO:0010224 response to UV-B Biological Process
GO:0010374 stomatal complex development Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process
GO:0045746 negative regulation of Notch signaling pathway Biological Process
GO:0050821 protein stabilization Biological Process
GO:0000785 chromatin Cellular Component
KEGG gene cross-reference
ath:AT1G76950
ath:AT5G63860
mmu:15204
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.479
Rank 1 · TkA06G074420 · TK1151
Nucleus0.433
Rank 2 · TkA06G074420 · TK1151
Mitochondrion0.136
Rank 3 · TkA06G074420 · TK1151
Cell membrane0.046
Rank 4 · TkA06G074420 · TK1151
Endoplasmic reticulum0.027
Rank 5 · TkA06G074420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25390WD40_RLD4-107 aa
PF13540RCC1_24-18 aa
PF00415RCC16-54 aa
PF25384Alsin_RLD7-53 aa
PF13540RCC1_241-73 aa
PF25384Alsin_RLD61-107 aa
PF00415RCC162-107 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G074420PF25390WD40_RLD41074e-1763.3
TkA06G074420PF13540RCC1_24185.9e-0729.8
TkA06G074420PF00415RCC16544.7e-2279.0
TkA06G074420PF25384Alsin_RLD7530.0001921.4
TkA06G074420PF13540RCC1_241735.9e-0729.8
TkA06G074420PF25384Alsin_RLD611070.0001921.4
TkA06G074420PF00415RCC1621074.7e-2279.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser