TkA06G074270 | RubberDandelionOmics

Gene overview

TkA06G074270

Reference: TK1151 Chr: Chr06 Coordinates: 19888541-19891509 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1537 bp · TkA06G074270|TK1151|cDNA

GGAAAAGCCCATATTTCTCCCCTGATCATTACACTATAAAAAATAAATTGCTTCCTTCTTCCTTTCATCCCTCACACTAGCGAAGCTTTCGCTGTTAAAACCCTCTTTCAAAACCCAAAGAGAAGCTCTAACACGCATCAAAGATGGATTCATCGTCTCCATCTCCATTGTCTCCGATTCATTTTGCATTAGCAACTTTGTTTGGAGCTTCAGTAATGGCGATCTCAGCCTTTTATATACACAAGCGCAGTGTTGATCAA...

CDS

Download CDS FASTA

801 bp · TkA06G074270|TK1151|CDS

ATGGATTCATCGTCTCCATCTCCATTGTCTCCGATTCATTTTGCATTAGCAACTTTGTTTGGAGCTTCAGTAATGGCGATCTCAGCCTTTTATATACACAAGCGCAGTGTTGATCAAGTCATCGAACGCCTCATCAAGCTCCGTCGACGGCCCGATCGGCCATACTCCGACCACGAAGATTTCTCTGCATACGAAGATGGAGATATTGATACTATGATGATAGAAATTATCTTGATGAAGACGACGACGATGATGGTGAT...

Protein

Download Protein FASTA

266 aa · TkA06G074270|TK1151|PROTEIN

MDSSSPSPLSPIHFALATLFGASVMAISAFYIHKRSVDQVIERLIKLRRRPDRPYSDHEDFSAYEDGDIDTMMIEIILMKTTTMMVMIMLGTLMLMVCRVSLPNVGLANEWTSENASKPVSFGSLEKLVSDNLPPLRMNQRQGEHHHDNQSNPKMRVGSYSRIHTPRSPASYAYDGADNSDDDGTETVVEEDTQYFDEGINSSAHDIYSNIQSMSLVLSENANNNQGKVNSTQPLTMAVKRWNIYQRTTQSTSQSMMAIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G074270`
TK1151 ID	TkA06G074270
OH-1004 ID	LXL04_025217
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.300
Protein coverage (%)	TK1151 87.218 / OH-1004 26.613 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G074270`
Location	Chr06:19888541-19891509 (-)
Description	Similar to AMPD: AMP deaminase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025217` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001708 cell fate specification Biological Process GO:0006188 IMP biosynthetic process Biological Process GO:0009117 nucleotide metabolic process Biological Process GO:0009167 purine ribonucleoside monophosphate metabolic process Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0030435 sporulation resulting in formation of a cellular spore Biological Process GO:0032263 GMP salvage Biological Process GO:0032264 IMP salvage Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0046033 AMP metabolic process Biological Process GO:0046034 ATP metabolic process Biological Process GO:0046039 GTP metabolic process Biological Process
KEGG gene cross-reference	ath:AT2G38280 ddi:DDB_G0292266 dosa:Os07g0693500 mmu:109674 rno:362015 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.292

Rank 1 · TkA06G074270 · TK1151

Cytoplasm0.278

Rank 2 · TkA06G074270 · TK1151

Endoplasmic reticulum0.193

Rank 3 · TkA06G074270 · TK1151

Mitochondrion0.167

Rank 4 · TkA06G074270 · TK1151

Cell membrane0.167

Rank 5 · TkA06G074270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15050SCIMP77-167 aa

PF08456Vmethyltransf_C208-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G074270	`PF15050`	SCIMP	77	167	0.024	15.8
TkA06G074270	`PF08456`	Vmethyltransf_C	208	257	0.039	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card