TkA06G073210 | RubberDandelionOmics

Gene overview

TkA06G073210

Reference: TK1151 Chr: Chr06 Coordinates: 19624858-19626954 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1014 bp · TkA06G073210|TK1151|cDNA

AAGTGGTCGTGCGTAACATCCAAGCACACCCAATAAAAAAAACCCTAGAAATTCCCAATCCGTATATTATCAAACTCACATCTTGTCTTCATCCACCCTCCACCCATTCCACCAAAGGGGAAGGGAACGTACAATGGCAACTATGCCCGACAGCTGCTTCGACTCGACCGGTGGTGCCGTCTCCTCCTCCTCCCCCGTTTACAATCGCGGAAAAGCTATCATGCTATTCGGCGTTAGATTGACAGAAGACGGTGGATCTT...

CDS

Download CDS FASTA

741 bp · TkA06G073210|TK1151|CDS

ATGGCAACTATGCCCGACAGCTGCTTCGACTCGACCGGTGGTGCCGTCTCCTCCTCCTCCCCCGTTTACAATCGCGGAAAAGCTATCATGCTATTCGGCGTTAGATTGACAGAAGACGGTGGATCTTCCTTCAGGAAGAGTGCTAGCATGAATAATCTAGCTCAGTTTGAGTGCCAGCCTCCAGATTCCAATATAGATGCCGCCGGCTACGCCTCCGATGACGTCATTCATCCTTCTGCTCGTAGCCATGACCGGAAAAG...

Protein

Download Protein FASTA

246 aa · TkA06G073210|TK1151|PROTEIN

MATMPDSCFDSTGGAVSSSSPVYNRGKAIMLFGVRLTEDGGSSFRKSASMNNLAQFECQPPDSNIDAAGYASDDVIHPSARSHDRKRGVPWTEEEHRLFLVGLHKVGKGDWRGISRNFVKSRTPTQVASHAQKYFLRLNNNNRRRRRSSLFDITTETYTEDQQQPPEKHLLSSLPATTEEYNLMKSVTPGPTPPSTKMANLNLNSTEEDVDHQTSLPLTLNLSLNNFQEISATFNTNSGDTVISVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G073210`
TK1151 ID	TkA06G073210
OH-1004 ID	LXL04_011512
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.300
Protein coverage (%)	TK1151 45.935 / OH-1004 39.130 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G073210

Location Chr06:19624858-19626954 (+)

Description Similar to KUA1: Transcription factor KUA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47390`	Transcriptional repressor.	A novel Arabidopsis MYB-like transcription factor, MYBH, regulates hypocotyl elongation by enhancing auxin accumulation.2013 · DOI: 10.1093/jxb/ert223 Transcriptional control of ROS homeostasis by KUODA1 regulates cell expansion during leaf development.2014 · DOI: 10.1038/ncomms4767 A single-repeat MYB transcription repressor, MYBH, participates in regulation of leaf senescence in Arabidopsis.2015 · DOI: 10.1007/s11103-015-0321-2
`At5g61620`	Probable transcription factor involved in somatic embryogenesis.	Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.2016 · DOI: 10.1016/j.jplph.2016.02.012

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0561400`	Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters.	Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of alpha-amylase gene expression.2002 · DOI: 10.1105/tpc.001735 A novel MYBS3-dependent pathway confers cold tolerance in rice.2010 · DOI: 10.1104/pp.110.153015
`UniProt: B8A9B2`	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011512 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT5G47390

ath:AT5G61620

dosa:Os10g0562100

osa:4349391

sot:102577613

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkA06G073210 · TK1151

Cytoplasm0.104

Rank 2 · TkA06G073210 · TK1151

Cell membrane0.029

Rank 3 · TkA06G073210 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA06G073210 · TK1151

Plastid0.013

Rank 5 · TkA06G073210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding89-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G073210	`PF00249`	Myb_DNA-binding	89	135	2.7e-11	44.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVS0`	Arabidopsis thaliana	sp\|Q9LVS0\|KUA1_ARATH Transcription factor KUA1	55.400%	Swiss-Prot	Low
`Q9FKF9`	Arabidopsis thaliana	sp\|Q9FKF9\|M5162_ARATH Probable transcription factor At5g61620	49.200%	Swiss-Prot	Low
`Q7XC57`	Oryza sativa subsp. japonica	sp\|Q7XC57\|MYBS3_ORYSJ Transcription factor MYBS3	59.400%	Swiss-Prot	Low
`B8A9B2`	Oryza sativa subsp. indica	sp\|B8A9B2\|MYBS1_ORYSI Transcription factor MYBS1	77.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card