RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G072930
Reference: TK1151 Chr: Chr06 Coordinates: 19553226-19558554 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3803 bp · TkA06G072930|TK1151|cDNA

CCCCCCCCCCCTTGGTCTCTTCTCTCCCTTTTCTGCATCTCACACACTGTGTGTGAAATATATACACATAAAAAAATTATAAATAGCCTATATACATACACAAAACTGTATCTATATCTCGTCTCTAAATTGTATTTCTGAATTGAGAGATTCACTTTATTCATTGGAGACGGCTTATATGGTTTGATGCACACACATATAGATACTGGTTTGTGCATATTAGTTTTTGGAAAGTTCGATGGCGAATTTTGCGAATTTAA...

CDS

Download CDS FASTA

3330 bp · TkA06G072930|TK1151|CDS

ATGGTTGACGGTGATCTGTTTACAGGGATGAAACGGTCTAGAGATGATGATGATGCCTACAGCAGCTCCCAACTCAAGCGACCACTGATCTCCGAACACTCAAAGCACCCCCAAATGATGGACAAAGGCACTGCACAGAAACTGACGGCTAACGATGCCCTAACATACCTCGAGAAAGTGAAAGACATATTCCAAAACGAGAAGGAAAAATACGACGAGTTTCTCAAAATCATGAAGGATTTCAAGGCGCAAAGAATTGA...

Protein

Download Protein FASTA

1109 aa · TkA06G072930|TK1151|PROTEIN

MVDGDLFTGMKRSRDDDDAYSSSQLKRPLISEHSKHPQMMDKGTAQKLTANDALTYLEKVKDIFQNEKEKYDEFLKIMKDFKAQRIDTTGVITMVKELFKGHQELLLGFNPFLPKGFQITLPLDNHQQHHVIKKPLEMEEAVLFVNKIKMRFQGQDHVYKYFLDTLNKYKKENKSIKEVHQEVAALLNDQQDLLKEFINFLPNPSHTECKVNLDRPDPGHQKEYTTPDKDFNRTHGEKQKDTSEDTIQREHDQDDKDCDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G072930
TK1151 IDTkA06G072930
OH-1004 IDLXL04_025234
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.400
Protein coverage (%)TK1151 94.409 / OH-1004 46.634
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G072930
LocationChr06:19553226-19558554 (-)
DescriptionSimilar to ISE2: DExH-box ATP-dependent RNA helicase DExH15 chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g70060 Acts as a transcriptional repressor. No verified direct reference in this release
At1g24190 Acts as a transcriptional repressor.
Role of an Arabidopsis AP2/EREBP-type transcriptional repressor in abscisic acid and drought stress responses.2005 · DOI: 10.1105/tpc.105.033043
At5g15020 Acts as a transcriptional repressor. No verified direct reference in this release
At1g59890 Acts as a transcriptional repressor. No verified direct reference in this release
At1g10450 Acts as a transcriptional repressor. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025234 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process
GO:0000373 Group II intron splicing Biological Process
GO:0000712 resolution of meiotic recombination intermediates Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006397 mRNA processing Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0010497 plasmodesmata-mediated intercellular transport Biological Process
GO:0016441 post-transcriptional gene silencing Biological Process
GO:0016554 cytidine to uridine editing Biological Process
GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
KEGG gene cross-reference
ath:AT1G24190
ath:AT1G70060
ath:AT1G70070
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.827
Rank 1 · TkA06G072930 · TK1151
Cytoplasm0.181
Rank 2 · TkA06G072930 · TK1151
Cell membrane0.049
Rank 3 · TkA06G072930 · TK1151
Endoplasmic reticulum0.020
Rank 4 · TkA06G072930 · TK1151
Lysosome / Vacuole0.018
Rank 5 · TkA06G072930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08349DUF172238-105 aa
PF16879Sin3a_C52-91 aa
PF02284COX5A53-81 aa
PF23202PAH_ZNF59856-102 aa
PF28774DUF845760-80 aa
PF02671PAH69-113 aa
PF28774DUF845792-105 aa
PF28774DUF8457136-201 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G072930PF08349DUF1722381050.09713.6
TkA06G072930PF16879Sin3a_C52911.9e-41143.2
TkA06G072930PF02284COX5A53810.5511.0
TkA06G072930PF23202PAH_ZNF598561022.8e-1763.5
TkA06G072930PF28774DUF845760800.8710.7
TkA06G072930PF02671PAH691131.8e-43146.7
TkA06G072930PF28774DUF8457921050.8710.7
TkA06G072930PF28774DUF84571362010.8710.7
TkA06G072930PF02284COX5A1401720.5511.0
TkA06G072930PF23202PAH_ZNF5981442052.8e-1763.5
TkA06G072930PF16879Sin3a_C1461681.9e-41143.2
TkA06G072930PF02671PAH1572011.8e-43146.7
TkA06G072930PF08349DUF17221581790.09713.6
TkA06G072930PF23202PAH_ZNF5982712942.8e-1763.5
TkA06G072930PF02671PAH2832931.8e-43146.7
TkA06G072930PF23202PAH_ZNF5983033652.8e-1763.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O04539Arabidopsis thalianasp|O04539|SNL4_ARATH Paired amphipathic helix protein Sin3-like 441.700%Swiss-ProtMedium
O48686Arabidopsis thalianasp|O48686|SNL3_ARATH Paired amphipathic helix protein Sin3-like 340.000%Swiss-ProtMedium
Q9LFQ3Arabidopsis thalianasp|Q9LFQ3|SNL2_ARATH Paired amphipathic helix protein Sin3-like 237.700%Swiss-ProtMedium
Q9XIE1Arabidopsis thalianasp|Q9XIE1|SNL5_ARATH Paired amphipathic helix protein Sin3-like 539.100%Swiss-ProtMedium
Q9XIK6Arabidopsis thalianasp|Q9XIK6|SNL6_ARATH Paired amphipathic helix protein Sin3-like 636.800%Swiss-ProtMedium

JBrowse

View in Genome Browser