TkA06G072780 | RubberDandelionOmics

Gene overview

TkA06G072780

Reference: TK1151 Chr: Chr06 Coordinates: 19509360-19510584 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1125 bp · TkA06G072780|TK1151|cDNA

ATGGGTCGTTTTCGATTTTGCAGTCGATCGTTAAACGACGCCATTATCGCTCTGTTATTGTTATCTTTCCCTATGATGTGCTTTGGGATTCGTTATTTTTCTTCCAACGGAGATATTGAGGCTCATTCGGGATCTGAGGTTTTGTTTGGCTATACTGAAGCGCCGGAATACCGAAACGGCGTAGGCTGCTCACGCGATAGCATTCATGTCGCAATGACGATCGACTTGGAGTACTTACGTGGCTCGATAGCCGCCGTACA...

CDS

Download CDS FASTA

1125 bp · TkA06G072780|TK1151|CDS

ATGGGTCGTTTTCGATTTTGCAGTCGATCGTTAAACGACGCCATTATCGCTCTGTTATTGTTATCTTTCCCTATGATGTGCTTTGGGATTCGTTATTTTTCTTCCAACGGAGATATTGAGGCTCATTCGGGATCTGAGGTTTTGTTTGGCTATACTGAAGCGCCGGAATACCGAAACGGCGTAGGCTGCTCACGCGATAGCATTCATGTCGCAATGACGATCGACTTGGAGTACTTACGTGGCTCGATAGCCGCCGTACA...

Protein

Download Protein FASTA

374 aa · TkA06G072780|TK1151|PROTEIN

MGRFRFCSRSLNDAIIALLLLSFPMMCFGIRYFSSNGDIEAHSGSEVLFGYTEAPEYRNGVGCSRDSIHVAMTIDLEYLRGSIAAVHSVLRHASCPENVHFHFIAAEFDPASPRDLTRLVRSTFPSLNFKVYIFREDTVINLISSSIRIALENPLNYARNYLGDILDPYVDRVIYLDSDVVIVDDIQKLWNITLQNNRVIGAPEYCHTNFTKYFTDSFWSDPMMSRVFGSRKPCYFNTGVMVMDMEKWRKGNYRKRIENW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G072780`
TK1151 ID	TkA06G072780
OH-1004 ID	LXL04_025236
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.861 / OH-1004 82.063 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G072780

Location Chr06:19509360-19510584 (-)

Description Similar to GATL9: Probable galacturonosyltransferase-like 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70090`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g24170`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g28340`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At4g02130`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g62660`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025236 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0047262 polygalacturonate 4-alpha-galacturonosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G24170

ath:AT1G70090

ath:AT3G28340

ath:AT3G62660

ath:AT4G02130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.774

Rank 1 · TkA06G072780 · TK1151

Endoplasmic reticulum0.093

Rank 2 · TkA06G072780 · TK1151

Cytoplasm0.068

Rank 3 · TkA06G072780 · TK1151

Cell membrane0.063

Rank 4 · TkA06G072780 · TK1151

Extracellular0.053

Rank 5 · TkA06G072780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01501Glyco_transf_869-329 aa

PF18404Glyco_transf_2499-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G072780	`PF01501`	Glyco_transf_8	69	329	2.8e-57	194.9
TkA06G072780	`PF18404`	Glyco_transf_24	99	253	7.1e-06	26.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04536`	Arabidopsis thaliana	sp\|O04536\|GATL9_ARATH Probable galacturonosyltransferase-like 9	70.600%	Swiss-Prot	High
`O48684`	Arabidopsis thaliana	sp\|O48684\|GATL8_ARATH Probable galacturonosyltransferase-like 8	69.700%	Swiss-Prot	High
`Q9LHD2`	Arabidopsis thaliana	sp\|Q9LHD2\|GATLA_ARATH Probable galacturonosyltransferase-like 10	65.800%	Swiss-Prot	High
`O04253`	Arabidopsis thaliana	sp\|O04253\|GATL6_ARATH Probable galacturonosyltransferase-like 6	67.700%	Swiss-Prot	High
`Q8VYF4`	Arabidopsis thaliana	sp\|Q8VYF4\|GATL7_ARATH Probable galacturonosyltransferase-like 7	64.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card