TkA06G072540 | RubberDandelionOmics

Gene overview

TkA06G072540

Reference: TK1151 Chr: Chr06 Coordinates: 19462922-19463578 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

369 bp · TkA06G072540|TK1151|cDNA

ATGTGCCGCCTCTGTTTCTCAGGTGAAAATGAGGAAAGTGAGAGAGCTAAAAAGATGCTACCATGCAAAAACTGTAACAAGAAATATCACAGAACCTGTGTGAAGTCATGGGCTCAAAATCGAGATCTGTTTCACTGGAGTCCTTGGACCTGCCCTTCATGTCGTACATGCGAGGTGTGCAGAAGGACTGGTGATCCAAATAAGCTTATGTATTGCAAAAGGTGTGATGGTGCTTATCATTGTTACTGTCAGAATGTGAG...

CDS

Download CDS FASTA

369 bp · TkA06G072540|TK1151|CDS

ATGTGCCGCCTCTGTTTCTCAGGTGAAAATGAGGAAAGTGAGAGAGCTAAAAAGATGCTACCATGCAAAAACTGTAACAAGAAATATCACAGAACCTGTGTGAAGTCATGGGCTCAAAATCGAGATCTGTTTCACTGGAGTCCTTGGACCTGCCCTTCATGTCGTACATGCGAGGTGTGCAGAAGGACTGGTGATCCAAATAAGCTTATGTATTGCAAAAGGTGTGATGGTGCTTATCATTGTTACTGTCAGAATGTGAG...

Protein

Download Protein FASTA

122 aa · TkA06G072540|TK1151|PROTEIN

MCRLCFSGENEESERAKKMLPCKNCNKKYHRTCVKSWAQNRDLFHWSPWTCPSCRTCEVCRRTGDPNKLMYCKRCDGAYHCYCQNVRTLFVPQAYKVSQLCFHSSWKWFKCQVCFFHIFLIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G072540`
TK1151 ID	TkA06G072540
OH-1004 ID	LXL04_010848
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.600
Protein coverage (%)	TK1151 68.852 / OH-1004 11.667 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G072540`
Location	Chr06:19462922-19463578 (+)
Description	Similar to KMT2B: Histone-lysine N-methyltransferase 2B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010848` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0010468 regulation of gene expression Biological Process GO:0031507 heterochromatin formation Biological Process GO:0032259 methylation Biological Process GO:0032922 circadian regulation of gene expression Biological Process GO:0033148 positive regulation of intracellular estrogen receptor signaling pathway Biological Process GO:0035864 response to potassium ion Biological Process GO:0043627 response to estrogen Biological Process GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process
KEGG gene cross-reference	hsa:4297 hsa:9757 mmu:75410 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.730

Rank 1 · TkA06G072540 · TK1151

Cytoplasm0.285

Rank 2 · TkA06G072540 · TK1151

Mitochondrion0.040

Rank 3 · TkA06G072540 · TK1151

Cell membrane0.036

Rank 4 · TkA06G072540 · TK1151

Endoplasmic reticulum0.029

Rank 5 · TkA06G072540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00628PHD2-54 aa

PF23004PHDvar_NSD2-36 aa

PF16866PHD_42-54 aa

PF13639zf-RING_22-55 aa

PF15446zf-PHD-like2-37 aa

PF22908PHD_NSD5-52 aa

PF14446Prok-RING_111-38 aa

PF00130C1_113-39 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G072540	`PF00628`	PHD	2	54	4.7e-10	40.0
TkA06G072540	`PF23004`	PHDvar_NSD	2	36	6.3e-07	30.0
TkA06G072540	`PF16866`	PHD_4	2	54	0.00064	20.3
TkA06G072540	`PF13639`	zf-RING_2	2	55	0.0044	18.0
TkA06G072540	`PF15446`	zf-PHD-like	2	37	0.049	13.9
TkA06G072540	`PF22908`	PHD_NSD	5	52	0.00028	21.8
TkA06G072540	`PF14446`	Prok-RING_1	11	38	2.4	9.1
TkA06G072540	`PF00130`	C1_1	13	39	0.038	14.5
TkA06G072540	`PF16744`	zf-RING_15	14	36	0.15	12.9
TkA06G072540	`PF00130`	C1_1	45	85	0.038	14.5
TkA06G072540	`PF22908`	PHD_NSD	56	86	0.00028	21.8
TkA06G072540	`PF16866`	PHD_4	56	110	0.00064	20.3
TkA06G072540	`PF13639`	zf-RING_2	56	83	0.0044	18.0
TkA06G072540	`PF16744`	zf-RING_15	56	85	0.15	12.9
TkA06G072540	`PF14446`	Prok-RING_1	56	84	2.4	9.1
TkA06G072540	`PF00628`	PHD	57	88	4.7e-10	40.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card