TkA06G069950 | RubberDandelionOmics

Gene overview

TkA06G069950

Reference: TK1151 Chr: Chr06 Coordinates: 18712797-18715869 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1858 bp · TkA06G069950|TK1151|cDNA

TTCCTTCACAGTTCAAACACTGCTCCGTTCCCTAATTTCCCTCTTGGCCTCTTCGTCTCTTCGACTATCGCCCGACGGCCGATGCCCATCGTCCATCGTCGCCGGCCTCGCACCTCCGGCGTCCTCGTAACTCACACCTCCGGCACAGGTAAGTCGAAGCTTCAATCGCGATTCCGCCTGTGAGCCTGTCGAATCTTCATCTCCGGCGTCTACTAGAGGACCACAACCCTACCACAACCGGCGATTACCACAGGTTGTGA...

CDS

Download CDS FASTA

348 bp · TkA06G069950|TK1151|CDS

ATGGTAATGAAGAAGGTACTGCGTGTGAAAACTATCAGCAAGGAGACGAAAATTTGCCGGAAAGAAGCTCTAACGAAGCTCTTGAGATGGAATTTTGGGCATCCGGAGTATCGAGGAAAGCAATTGGAAGCCATTGAAGCTGTTTTATCCGGTTTTTCGTTCATACTCGTTTTTCTCTCACAGCGGAAGAGATTGCTTCTGTCAAATTGTTACCAAACCCCCGCCCTAGCAAAACGGGGCATTGTGCTTGTTGTTTCTCC...

Protein

Download Protein FASTA

115 aa · TkA06G069950|TK1151|PROTEIN

MVMKKVLRVKTISKETKICRKEALTKLLRWNFGHPEYRGKQLEAIEAVLSGFSFILVFLSQRKRLLLSNCYQTPALAKRGIVLVVSPLKGERSITIIWMVIKVEPCTTQCFLCFH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G069950`
TK1151 ID	TkA06G069950
OH-1004 ID	LXL04_018577
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	76.100
Protein coverage (%)	TK1151 93.913 / OH-1004 14.915 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G069950

Location Chr06:18712797-18715869 (+)

Description Similar to RECQL3: ATP-dependent DNA helicase Q-like 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35740`	3'-5' DNA helicase that may play a role in the repair of DNA.	Biochemical characterization of AtRECQ3 reveals significant differences relative to other RecQ helicases.2009 · DOI: 10.1104/pp.109.144709

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018577 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000077 DNA damage checkpoint signaling Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0000712 resolution of meiotic recombination intermediates Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000731 DNA synthesis involved in DNA repair Biological Process

GO:0000732 DNA strand displacement Biological Process

GO:0006259 DNA metabolic process Biological Process

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006310 DNA recombination Biological Process

KEGG gene cross-reference

ath:AT4G35740

cel:CELE_T04A11.6

dme:Dmel_CG6920

hsa:9400

mmu:170472

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.569

Rank 1 · TkA06G069950 · TK1151

Cytoplasm0.350

Rank 2 · TkA06G069950 · TK1151

Mitochondrion0.073

Rank 3 · TkA06G069950 · TK1151

Endoplasmic reticulum0.056

Rank 4 · TkA06G069950 · TK1151

Extracellular0.046

Rank 5 · TkA06G069950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21697Ppx_C10-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G069950	`PF21697`	Ppx_C	10	92	0.038	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FT72`	Arabidopsis thaliana	sp\|Q9FT72\|RQL3_ARATH ATP-dependent DNA helicase Q-like 3	59.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card