Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1936 bp · TkA06G069940|TK1151|cDNA
CTCTTTTAATAATAAGACCAACCAAATTCGCAATTCATCCATATCTTCTCAACATAAATCTACAAATCTTTTGTAGTACTTCGTTTCAATCCTGGTTTGTTTATGTGGAATTGCTGATTCAGTTTCTAGTATTAGGGTTTTTGTTTGATGGGTGTGGAGGGAGAGTCAACTCAAGCAGGCGTCTCCACCGTTGACGGTGGCGATGCAGAAATCACCCTCAACATCCGATGCTCTAACGGCAACAAGTTCTCGGTGCGAGC...
1554 bp · TkA06G069940|TK1151|CDS
ATGGGTGTGGAGGGAGAGTCAACTCAAGCAGGCGTCTCCACCGTTGACGGTGGCGATGCAGAAATCACCCTCAACATCCGATGCTCTAACGGCAACAAGTTCTCGGTGCGAGCAAGCCTCGGATCAACCGTCGTCTCTTTCAAAGATATCTTGGCCCAAAACTGCGATGTTCCTGCCAATCAACAGAGATTGATTTACAAAGGAAGAATCCTGAAGGACGATCAAACCCTAGATAGTTACGGCCTGCAGGCAGATCATAC...
Protein
Download Protein FASTA517 aa · TkA06G069940|TK1151|PROTEIN
MGVEGESTQAGVSTVDGGDAEITLNIRCSNGNKFSVRASLGSTVVSFKDILAQNCDVPANQQRLIYKGRILKDDQTLDSYGLQADHTIHMVRGSSPAPTTNTPATGNPNPNPPTLNEGIASGAPLFPGLGLGSLGGSAAPYGAGLPDFEQVQQQLTQNPNMMRDMMNMPAIQNILNNPEVMRGMIMSNPQMREIIDRNPELAHILNDPAILRQTLEAARNPELMREMMRNTDRAMSNIESSPEGFNMLRRMYENVQEPFL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G069940 |
|---|---|
| TK1151 ID | TkA06G069940 |
| OH-1004 ID | LXL04_025286 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 95.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 92.021Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G069940 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:18706905-18709616 (+) | |||||||||
| Description | Similar to DSK2B: Ubiquitin domain-containing protein DSK2b | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000045 autophagosome assembly Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0016236 macroautophagy Biological Process GO:0016241 regulation of macroautophagy Biological Process GO:0031396 regulation of protein ubiquitination Biological Process GO:0031398 positive regulation of protein ubiquitination Biological Process GO:0034140 negative regulation of toll-like receptor 3 signaling pathway Biological Process GO:0034976 response to endoplasmic reticulum stress Biological Process GO:0035973 aggrephagy Biological Process GO:0036503 ERAD pathway Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0097352 autophagosome maturation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G17190 ath:AT2G17200 hsa:29979 mmu:56085 rno:114590 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF11976Rad60-SLD22-91 aaPF14560Ubiquitin_222-90 aaPF00240ubiquitin24-92 aaPF10302Dsc3_N42-81 aaPF18037Ubiquitin_547-84 aaPF13881Rad60-SLD_259-90 aaPF17830STI1-HOP_DP146-176 aaPF09280XPC-binding146-172 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G069940 | PF11976 | Rad60-SLD | 22 | 91 | 8e-09 | 35.9 |
| TkA06G069940 | PF14560 | Ubiquitin_2 | 22 | 90 | 0.005 | 18.0 |
| TkA06G069940 | PF00240 | ubiquitin | 24 | 92 | 3.7e-20 | 72.2 |
| TkA06G069940 | PF10302 | Dsc3_N | 42 | 81 | 0.06 | 14.6 |
| TkA06G069940 | PF18037 | Ubiquitin_5 | 47 | 84 | 0.14 | 13.2 |
| TkA06G069940 | PF13881 | Rad60-SLD_2 | 59 | 90 | 0.044 | 14.6 |
| TkA06G069940 | PF17830 | STI1-HOP_DP | 146 | 176 | 7.2e-06 | 26.5 |
| TkA06G069940 | PF09280 | XPC-binding | 146 | 172 | 0.0043 | 17.4 |
| TkA06G069940 | PF29073 | RxLR_C | 146 | 175 | 0.014 | 16.4 |
| TkA06G069940 | PF24669 | Ddi2_HDD | 149 | 162 | 0.3 | 11.9 |
| TkA06G069940 | PF16550 | RPN13_C | 150 | 208 | 0.24 | 12.3 |
| TkA06G069940 | PF23195 | UBQLN1 | 154 | 278 | 2.2e-62 | 208.9 |
| TkA06G069940 | PF07200 | Mod_r | 166 | 194 | 0.042 | 14.5 |
| TkA06G069940 | PF07426 | Dynactin_p22 | 171 | 213 | 0.075 | 13.6 |
| TkA06G069940 | PF17830 | STI1-HOP_DP | 173 | 196 | 7.2e-06 | 26.5 |
| TkA06G069940 | PF18312 | ScsC_N | 174 | 182 | 0.97 | 9.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.