TkA06G065060 | RubberDandelionOmics

Gene overview

TkA06G065060

Reference: TK1151 Chr: Chr06 Coordinates: 17503205-17505027 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1219 bp · TkA06G065060|TK1151|cDNA

TTAAGAAAGAGTATATTTACACCTCAAGTTCTTCAAACGTTCAACAAATTTTCCCCCAAAATCCTCCGACACGTCGCCACCAGATTACCACCGTAGTCAAACCCTAGCCACTGCGCCGTAATCCTAATCCTCACCATTTCCACCTCGCCACCAGAAATACGTACACAAAGCATTTGCAAAACCGCGCAGATTTGAAAAGGAAACATGAGGCCACCGAAGAAGACGATCCACGTGATATCGTCATGGATACGCCGGCAACC...

CDS

Download CDS FASTA

819 bp · TkA06G065060|TK1151|CDS

ATGAGGCCACCGAAGAAGACGATCCACGTGATATCGTCATGGATACGCCGGCAACCGCCAAAGATCAAAGCTTTTTTGGCCGTAGTCGCTGGCATGGTGGCGTTGGTGTTGTTACGCGCGATTGTGCACGATCATGACAATCTCTTCATTGCTGCCGAAGCTGTTCACTCCATCGGAATCGCCGTTCTCATATACAAGCTCTCCAAGGAAAAAACTTGCGCTGGCATATCACTGAAATCGCAAGACCTAACAGCAATGTT...

Protein

Download Protein FASTA

272 aa · TkA06G065060|TK1151|PROTEIN

MRPPKKTIHVISSWIRRQPPKIKAFLAVVAGMVALVLLRAIVHDHDNLFIAAEAVHSIGIAVLIYKLSKEKTCAGISLKSQDLTAMFLAVRLYCSFVMEYDIHTVLDLSTFAATLWVIFMIRFRLKSSYMEEKDNFAMYYVAVPCAILALLIHPSTTHNIINRILWAFCVYLEAVSVLPQLRVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDSRGYLLTALGYGLWPSMVLISEIVQTFILADFCYYYVKSVFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G065060`
TK1151 ID	TkA06G065060
OH-1004 ID	LXL04_025350
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G065060`
Location	Chr06:17503205-17505027 (+)
Description	Similar to erd-2.2: ER lumen protein-retaining receptor erd-2.2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025350` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006621 protein retention in ER lumen Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0036498 IRE1-mediated unfolded protein response Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005801 cis-Golgi network Cellular Component GO:0005046 KDEL sequence binding Molecular Function GO:0046923 ER retention sequence binding Molecular Function
KEGG gene cross-reference	cbr:CBG_17162 cel:CELE_C28H8.4 cel:CELE_F09B9.3 ddi:DDB_G0272124 dme:Dmel_CG5183 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.489

Rank 1 · TkA06G065060 · TK1151

Golgi apparatus0.489

Rank 2 · TkA06G065060 · TK1151

Cytoplasm0.133

Rank 3 · TkA06G065060 · TK1151

Cell membrane0.069

Rank 4 · TkA06G065060 · TK1151

Nucleus0.068

Rank 5 · TkA06G065060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10801DUF253722-67 aa

PF03609EII-Sor31-72 aa

PF00810ER_lumen_recept39-51 aa

PF04193PQ-loop64-79 aa

PF00810ER_lumen_recept72-214 aa

PF10801DUF2537107-121 aa

PF04193PQ-loop110-119 aa

PF04193PQ-loop162-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G065060	`PF10801`	DUF2537	22	67	0.2	12.6
TkA06G065060	`PF03609`	EII-Sor	31	72	0.025	14.8
TkA06G065060	`PF00810`	ER_lumen_recept	39	51	6e-43	147.8
TkA06G065060	`PF04193`	PQ-loop	64	79	0.27	11.7
TkA06G065060	`PF00810`	ER_lumen_recept	72	214	6e-43	147.8
TkA06G065060	`PF10801`	DUF2537	107	121	0.2	12.6
TkA06G065060	`PF04193`	PQ-loop	110	119	0.27	11.7
TkA06G065060	`PF04193`	PQ-loop	162	216	0.27	11.7
TkA06G065060	`PF10801`	DUF2537	172	175	0.2	12.6
TkA06G065060	`PF03609`	EII-Sor	203	256	0.025	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card