TkA06G064270 | RubberDandelionOmics

Gene overview

TkA06G064270

Reference: TK1151 Chr: Chr06 Coordinates: 17320155-17327230 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1234 bp · TkA06G064270|TK1151|cDNA

TATCAAGTTTGCATCAAATTGCATACTATTTTGTAATTGTCCTTATTTCAGTTTACATCCAGATGTCAAAACTTTCATGCTTATATAACCCATCTGGAGCTCGATATCATCGTTGTTGAATCTCTCGCCATTCCGATTGTCGTCGAATTCTACATCTGTCACAAGCATTCGATCATGGCGAAGATTAGGGTTTCGTTCATCCTCGCTTTAGTTCTTCTTCTGTCCTCTTCTTTCTTTCTTCAAGTTGCTAGGTCACAGTC...

CDS

Download CDS FASTA

1779 bp · TkA06G064270|TK1151|CDS

ATGTCGGGCATGGGGGACGGGTACGTGGGTACCGCCCAAGACGCTGTAAGGATCCGAAGGCTCGAGAAACAAAGAGAGGCGGAAAGGAAAAAGATCCAAGAGCTCAAAAGTAAGAACGCAAAAGGCCAATCCGGTCTTCTCCAATTCGGCTCCGGAACCTCCGAAATTCTTGAAACTGCCTTCAAGAAGGAAACAGTTGGGCTTGTCACAAGGGAGCAGTATGTTGAAAAGAGGGTTAACATTCGAACCAAAATTGAAGA...

Protein

Download Protein FASTA

592 aa · TkA06G064270|TK1151|PROTEIN

MSGMGDGYVGTAQDAVRIRRLEKQREAERKKIQELKSKNAKGQSGLLQFGSGTSEILETAFKKETVGLVTREQYVEKRVNIRTKIEEEEKEKLQKLQQEEEELQLQKLKKRKVKANPKLSFSEDIENGEEEEEDDGEDTYSFSEREAEEQAERERLRKQWLREQEQIKNEALEITYSYWDGAGHRRVMQVRKGDTIGEFLRSVQQQLAPEFREIRTTSVENLLYVKEDLIIPHQHSFYELIVNKARGKSGPLFHFDVHED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G064270`
TK1151 ID	TkA06G064270
OH-1004 ID	LXL04_025339
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G064270

Location Chr06:17320155-17327230 (-)

Description Similar to XCT: Protein XAP5 CIRCADIAN TIMEKEEPER

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21150`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release
`At2g21160`	TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BDW1`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release
`Os09g0535300`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006397 mRNA processing Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009637 response to blue light Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010114 response to red light Biological Process

GO:0035196 miRNA processing Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0048511 rhythmic process Biological Process

KEGG gene cross-reference

ath:AT2G21150

dosa:Os09g0535300

hsa:9130

mmu:108161

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.764

Rank 1 · TkA06G064270 · TK1151

Nucleus0.185

Rank 2 · TkA06G064270 · TK1151

Cytoplasm0.117

Rank 3 · TkA06G064270 · TK1151

Golgi apparatus0.104

Rank 4 · TkA06G064270 · TK1151

Cell membrane0.049

Rank 5 · TkA06G064270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13580SIS_218-98 aa

PF20700Mutator30-124 aa

PF04921XAP580-112 aa

PF04921XAP5171-308 aa

PF04921XAP5324-339 aa

PF06639BAP348-383 aa

PF03896TRAP_alpha430-560 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G064270	`PF13580`	SIS_2	18	98	0.079	13.7
TkA06G064270	`PF20700`	Mutator	30	124	0.0033	17.1
TkA06G064270	`PF04921`	XAP5	80	112	3.2e-52	177.7
TkA06G064270	`PF04921`	XAP5	171	308	3.2e-52	177.7
TkA06G064270	`PF04921`	XAP5	324	339	3.2e-52	177.7
TkA06G064270	`PF06639`	BAP	348	383	0.27	12.3
TkA06G064270	`PF03896`	TRAP_alpha	430	560	3.1e-06	27.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H110`	Arabidopsis thaliana	sp\|Q8H110\|XCT_ARATH Protein XAP5 CIRCADIAN TIMEKEEPER	71.300%	Swiss-Prot	Medium
`P45434`	Arabidopsis thaliana	sp\|P45434\|SSRA_ARATH Translocon-associated protein subunit alpha	54.900%	Swiss-Prot	High
`B8BDW1`	Oryza sativa subsp. indica	sp\|B8BDW1\|XCT_ORYSI Protein XAP5 CIRCADIAN TIMEKEEPER	73.400%	Swiss-Prot	Medium
`Q69JZ7`	Oryza sativa subsp. japonica	sp\|Q69JZ7\|XCT_ORYSJ Protein XAP5 CIRCADIAN TIMEKEEPER	73.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card