TkA06G063450 | RubberDandelionOmics

Gene overview

TkA06G063450

Reference: TK1151 Chr: Chr06 Coordinates: 17105922-17109167 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1303 bp · TkA06G063450|TK1151|cDNA

GGCCTTTCCAAAAGAGAACCTGACCCATCTTTTGCAACTCGGCTCCTGTGAACATTACTCCTCCGCTGGCTTCGACTGTGCTTCGCAACAGCCATAACTCCTTCTGTGATTTTCTTCGACTGTGAAATCAACAGCCGTAACTCCTTCTGTGATTTTCTTCGGCATCTCGATGCTCTGCCCTCTGAAACCAACAGCCATAACTTCTTCCTATCTGTGAAATCGATTCCTCTGAAATCGCCATCGATCTCCCCTCTGAAATC...

CDS

Download CDS FASTA

597 bp · TkA06G063450|TK1151|CDS

ATGGAGGCAACAGTGAAAAAATTCCAGCAGAAATTCAAAAGGGTGAAAAACGACATGGATAGATGGGACGACCTCCATTCTCAATTACTTTCACAGTACAAAAACGCGTCTTCCATCATTGGAAGGTTACAGATACTCGAATACCCCAAAAACTACGGTTCCCTAAAAAACCTTGACAACATTAAAAACGCCATCTTCACAAAACAGCTGGAATCCCTACAGAAGATCATGCTTTCAATTACTAAAACTCTGGAGGAATT...

Protein

Download Protein FASTA

198 aa · TkA06G063450|TK1151|PROTEIN

MEATVKKFQQKFKRVKNDMDRWDDLHSQLLSQYKNASSIIGRLQILEYPKNYGSLKNLDNIKNAIFTKQLESLQKIMLSITKTLEELNSVVLVLAKTVHDAKQQVKGGSVQVSVKQLHHRIGVKPSIADCLEGLRILHEMYKSEYLLKSSVMSALASLALKPSVGDLQALERILIDQPNIPKEEVQSIYDVIFAEEIC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G063450`
TK1151 ID	TkA06G063450
OH-1004 ID	LXL04_035653
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.700
Protein coverage (%)	TK1151 100.000 / OH-1004 20.339 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G063450

Location Chr06:17105922-17109167 (+)

Description Similar to At5g22100: Probable RNA 3'-terminal phosphate cyclase-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43822`	Uncharacterized protein At5g43822.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035653 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000479 endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006364 rRNA processing Biological Process

GO:0030490 maturation of SSU-rRNA Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0032040 small-subunit processome Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

GO:0004521 RNA endonuclease activity Molecular Function

KEGG gene cross-reference

ath:AT5G22100

ddi:DDB_G0282803

hsa:10171

mmu:59028

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.528

Rank 1 · TkA06G063450 · TK1151

Nucleus0.317

Rank 2 · TkA06G063450 · TK1151

Golgi apparatus0.101

Rank 3 · TkA06G063450 · TK1151

Cell membrane0.094

Rank 4 · TkA06G063450 · TK1151

Mitochondrion0.082

Rank 5 · TkA06G063450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15011CA109-like2-197 aa

PF04102SlyX2-37 aa

PF28231STB2_C4-36 aa

PF07303Occludin_ELL4-37 aa

PF08702Fib_alpha5-34 aa

PF14942Muted44-104 aa

PF07303Occludin_ELL48-118 aa

PF28231STB2_C52-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G063450	`PF15011`	CA109-like	2	197	1.4e-53	182.1
TkA06G063450	`PF04102`	SlyX	2	37	0.88	11.0
TkA06G063450	`PF28231`	STB2_C	4	36	0.21	12.7
TkA06G063450	`PF07303`	Occludin_ELL	4	37	0.87	11.1
TkA06G063450	`PF08702`	Fib_alpha	5	34	0.17	12.8
TkA06G063450	`PF14942`	Muted	44	104	0.09	13.7
TkA06G063450	`PF07303`	Occludin_ELL	48	118	0.87	11.1
TkA06G063450	`PF28231`	STB2_C	52	106	0.21	12.7
TkA06G063450	`PF08702`	Fib_alpha	63	143	0.17	12.8
TkA06G063450	`PF09074`	Mer2	66	89	0.079	13.5
TkA06G063450	`PF04102`	SlyX	69	106	0.88	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPG7`	Arabidopsis thaliana	sp\|Q6NPG7\|Y5382_ARATH Uncharacterized protein At5g43822	44.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card