TkA06G060960 | RubberDandelionOmics

Gene overview

TkA06G060960

Reference: TK1151 Chr: Chr06 Coordinates: 16440622-16443683 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1504 bp · TkA06G060960|TK1151|cDNA

GAGCCGAGTTTTGCGACCGCCGGGATGCAGCCGCCGATATACAAAAAAGAGCGTATGTGTATGTGTCATATCAACTCATATTCGATATCAGTATATCACTCATCCACTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTATTATCGAATCAAAAGAGTTCATCAAAGCTTCTACGATCAGGTCTCTAACTAGCAGATCTAAGTTATATTCCCCCAATTACGAAAACCAGGAGCCAGTAGTCAGCAGACCCAACTTCTACAT...

CDS

Download CDS FASTA

900 bp · TkA06G060960|TK1151|CDS

ATGGCATTACCCGTGGATCACAAGGCCAACATAATTGATGGAAAAGCAATCGCCCAAACAATTCGTTCTGAAATCGCCTCTGAAGTCAGTACATTGATTGAGAAATATGGCAAGGCACCAGGACTTGCTGTGGTGATTGTGGGCCATAGAAAAGATTCTCAAAGTTACGTAAGCATGAAAAGAAAAGCATGCTACGAGGTTGGAATCAAGTCCATTGACATAGACCTTCCGGAACAAGTACCCGAATCCGAATTAATCGC...

Protein

Download Protein FASTA

299 aa · TkA06G060960|TK1151|PROTEIN

MALPVDHKANIIDGKAIAQTIRSEIASEVSTLIEKYGKAPGLAVVIVGHRKDSQSYVSMKRKACYEVGIKSIDIDLPEQVPESELIAKVHELNIDPNVHGILVQLPLPKHINEEKVLTEISIEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCIELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLLLKEDATVTVVHSRTENPETMIRDADIVIAAAGQPMMIKGSWIKEGAAVIDVGTNAVDDTSRKSGYRLVGDVDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G060960`
TK1151 ID	TkA06G060960
OH-1004 ID	LXL04_025414
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G060960

Location Chr06:16440622-16443683 (-)

Description Similar to FOLD2: Bifunctional protein FolD 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12290`	Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate.	No verified direct reference in this release
`At4g00620`	Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate.	No verified direct reference in this release
`At2g38660`	Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025414 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000105 L-histidine biosynthetic process Biological Process

GO:0006164 purine nucleotide biosynthetic process Biological Process

GO:0009086 methionine biosynthetic process Biological Process

GO:0009853 photorespiration Biological Process

GO:0035999 tetrahydrofolate interconversion Biological Process

GO:0046653 tetrahydrofolate metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004477 methenyltetrahydrofolate cyclohydrolase activity Molecular Function

GO:0004488 methylenetetrahydrofolate dehydrogenase (NADP+) activity Molecular Function

KEGG gene cross-reference

ath:AT2G38660

ath:AT3G12290

ath:AT4G00620

geo:Geob_1799

gur:Gura_1169

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.658

Rank 1 · TkA06G060960 · TK1151

Nucleus0.288

Rank 2 · TkA06G060960 · TK1151

Mitochondrion0.149

Rank 3 · TkA06G060960 · TK1151

Plastid0.096

Rank 4 · TkA06G060960 · TK1151

Peroxisome0.065

Rank 5 · TkA06G060960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00763THF_DHG_CYH12-127 aa

PF02882THF_DHG_CYH_C29-49 aa

PF09099Qn_am_d_aIII40-51 aa

PF09099Qn_am_d_aIII73-86 aa

PF09099Qn_am_d_aIII116-138 aa

PF02882THF_DHG_CYH_C148-295 aa

PF09099Qn_am_d_aIII166-177 aa

PF02423OCD_Mu_crystall202-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G060960	`PF00763`	THF_DHG_CYH	12	127	6.3e-43	146.4
TkA06G060960	`PF02882`	THF_DHG_CYH_C	29	49	5.3e-61	205.1
TkA06G060960	`PF09099`	Qn_am_d_aIII	40	51	0.098	13.7
TkA06G060960	`PF09099`	Qn_am_d_aIII	73	86	0.098	13.7
TkA06G060960	`PF09099`	Qn_am_d_aIII	116	138	0.098	13.7
TkA06G060960	`PF02882`	THF_DHG_CYH_C	148	295	5.3e-61	205.1
TkA06G060960	`PF09099`	Qn_am_d_aIII	166	177	0.098	13.7
TkA06G060960	`PF02423`	OCD_Mu_crystall	202	248	0.0067	16.2
TkA06G060960	`PF09099`	Qn_am_d_aIII	250	278	0.098	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHH7`	Arabidopsis thaliana	sp\|Q9LHH7\|FOLD2_ARATH Bifunctional protein FolD 2	79.300%	Swiss-Prot	High
`O65271`	Arabidopsis thaliana	sp\|O65271\|FOLD4_ARATH Bifunctional protein FolD 4, chloroplastic	64.200%	Swiss-Prot	High
`A2RVV7`	Arabidopsis thaliana	sp\|A2RVV7\|FOLD1_ARATH Bifunctional protein FolD 1, mitochondrial	60.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card