TkA06G059050 | RubberDandelionOmics

Gene overview

TkA06G059050

Reference: TK1151 Chr: Chr06 Coordinates: 15948285-15952236 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2660 bp · TkA06G059050|TK1151|cDNA

CAGCCAACTATTGCCAAACCCTTTTTCCTCTCATAATCAAACTCTATCTTTCCTTTCCTTTCCCTCACCGCTGCTATTTATTTTTCAATTGCACATTTCATTCTTTATCTGCAAAAAAGAAAAGCTTAAAAATCATCGATCTAACACCCTTCTCCCCTAATCTTTCACCTTTTTCATTAGCCAGCCTTTTATATAAGAACAAGAGACCAACTTTAGAGGAAAAGAGGAAAAAGAACTTCAGCTTTTAGGGTAAATCTGGC...

CDS

Download CDS FASTA

1806 bp · TkA06G059050|TK1151|CDS

ATGTTTAGGTTTTCGTGCTTCCATTCTCCCACTCATGCTCAGAAACCAAAGAAAACGGTGCAATTGCCTACGGAAGCAATGCAAAAAACATTGGAAGATTACCCGATAAGGCAACCGAAGAAAGATCCCGTCTCTTTAAAACAATCTCCAGAAGGCAAAAATTCCAATCAATCTCCATCTTCCACAGGTCAACAAGGTTGGAAATCCGAAGGACTGAAAAGCACAAACGACAACTACAGCCAAGATGGACACCAAATAAA...

Protein

Download Protein FASTA

601 aa · TkA06G059050|TK1151|PROTEIN

MFRFSCFHSPTHAQKPKKTVQLPTEAMQKTLEDYPIRQPKKDPVSLKQSPEGKNSNQSPSSTGQQGWKSEGLKSTNDNYSQDGHQIKTMRKSVSLGTGLAHYQDMPPGDESSSSHNNRSDEFHNAQASISPQISSNVVNHTAELSPENSGTQFSGEGSAGSSSRTPLAIVKSSSSPYLNSGHKSRSSEQLKALDSDNNSGEVSPENESEGHDEKNDGDDGGYDYVGSAKDWIVPAVDEMGKGKMVQEDYSDCRWEELPNE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G059050`
TK1151 ID	TkA06G059050
OH-1004 ID	LXL04_009772
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	52.200
Protein coverage (%)	TK1151 85.358 / OH-1004 98.431 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G059050`
Location	Chr06:15948285-15952236 (-)
Description	Similar to sds-22: Protein phosphatase 1 regulatory subunit SDS22 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009772` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0003341 cilium movement Biological Process GO:0007059 chromosome segregation Biological Process GO:0030317 flagellated sperm motility Biological Process GO:0046600 negative regulation of centriole replication Biological Process GO:0051301 cell division Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005813 centrosome Cellular Component GO:0005814 centriole Cellular Component GO:0005929 cilium Cellular Component GO:0005930 axoneme Cellular Component GO:0036126 sperm flagellum Cellular Component
KEGG gene cross-reference	cel:CELE_T09A5.9 ddi:DDB_G0284039 hsa:83450 xla:431936 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.435

Rank 1 · TkA06G059050 · TK1151

Cytoplasm0.381

Rank 2 · TkA06G059050 · TK1151

Nucleus0.298

Rank 3 · TkA06G059050 · TK1151

Golgi apparatus0.064

Rank 4 · TkA06G059050 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA06G059050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00560LRR_1190-204 aa

PF00560LRR_1272-279 aa

PF12799LRR_4339-362 aa

PF23598LRR_14346-480 aa

PF23211LRR_LRWD1347-410 aa

PF13516LRR_6350-362 aa

PF13855LRR_8351-406 aa

PF00560LRR_1351-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G059050	`PF00560`	LRR_1	190	204	1e-07	31.4
TkA06G059050	`PF00560`	LRR_1	272	279	1e-07	31.4
TkA06G059050	`PF12799`	LRR_4	339	362	2e-15	57.2
TkA06G059050	`PF23598`	LRR_14	346	480	0.0002	20.9
TkA06G059050	`PF23211`	LRR_LRWD1	347	410	0.092	13.2
TkA06G059050	`PF13516`	LRR_6	350	362	8.2e-05	23.1
TkA06G059050	`PF13855`	LRR_8	351	406	4.7e-22	78.2
TkA06G059050	`PF00560`	LRR_1	351	365	1e-07	31.4
TkA06G059050	`PF14580`	LRR_9	353	452	9.4e-09	35.8
TkA06G059050	`PF24048`	LRR_NXF1-5	363	404	0.033	14.5
TkA06G059050	`PF24048`	LRR_NXF1-5	363	429	0.033	14.5
TkA06G059050	`PF23952`	LRR_EndoS	367	459	0.0022	18.9
TkA06G059050	`PF13855`	LRR_8	372	429	4.7e-22	78.2
TkA06G059050	`PF12799`	LRR_4	374	407	2e-15	57.2
TkA06G059050	`PF00560`	LRR_1	374	387	1e-07	31.4
TkA06G059050	`PF13516`	LRR_6	374	385	8.2e-05	23.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card