TkA06G058060 | RubberDandelionOmics

Gene overview

TkA06G058060

Reference: TK1151 Chr: Chr06 Coordinates: 15656889-15658334 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1104 bp · TkA06G058060|TK1151|cDNA

CAAAGTGATTTCTCGGGTGGGTGTGTGAGAAAAACCGATTTACAATGTGGAAATAATAAGTGTTCATTTTGGAATGGAGATCTGTTAAACCTCTCAGAAGACAATGGTAATGGGAACAAAATCTACATTAAAGTTGCTTCTAAAGATCTTCCACGTCATAACAAAAGTAATCTGGTCAACATAGGTGCTGTTGTTGGGGCTGTGAAGAAAGAGAATAAAGGTTGGAAAGACGACAATGGAGGGATTGTTGGTGGCGGGAG...

CDS

Download CDS FASTA

1104 bp · TkA06G058060|TK1151|CDS

CAAAGTGATTTCTCGGGTGGGTGTGTGAGAAAAACCGATTTACAATGTGGAAATAATAAGTGTTCATTTTGGAATGGAGATCTGTTAAACCTCTCAGAAGACAATGGTAATGGGAACAAAATCTACATTAAAGTTGCTTCTAAAGATCTTCCACGTCATAACAAAAGTAATCTGGTCAACATAGGTGCTGTTGTTGGGGCTGTGAAGAAAGAGAATAAAGGTTGGAAAGACGACAATGGAGGGATTGTTGGTGGCGGGAG...

Protein

Download Protein FASTA

367 aa · TkA06G058060|TK1151|PROTEIN

QSDFSGGCVRKTDLQCGNNKCSFWNGDLLNLSEDNGNGNKIYIKVASKDLPRHNKSNLVNIGAVVGAVKKENKGWKDDNGGIVGGGRLGDLSIVAVKKLESIRQGEKEFRNEVSTIGTIQHVNLVRLRGFCAQVLNWVTRYQIALGTARGLVYLHDKCRECIIHCDIKPENILLDVDFCPKIADFGLAKLVGRDFSRVLTTARGSIGYIAPEWLSGVAVTPKADVYSYGMMLFELVHGKRNSEGSQDSRSKYFPSLVANA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G058060`
TK1151 ID	TkA06G058060
OH-1004 ID	LXL04_025464
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.500
Protein coverage (%)	TK1151 100.000 / OH-1004 59.900 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G058060

Location Chr06:15656889-15658334 (+)

Description Similar to At2g19130: G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19130`	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130.	No verified direct reference in this release
`At4g00340`	Serine/threonine-protein kinase.	No verified direct reference in this release
`At5g24080`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080.	No verified direct reference in this release
`At4g32300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5.	No verified direct reference in this release
`At1g34300`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025464 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0045087 innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G65790

ath:AT2G19130

ath:AT4G00340

ath:AT4G11900

ath:AT4G21380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.615

Rank 1 · TkA06G058060 · TK1151

Cytoplasm0.258

Rank 2 · TkA06G058060 · TK1151

Nucleus0.252

Rank 3 · TkA06G058060 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA06G058060 · TK1151

Golgi apparatus0.032

Rank 5 · TkA06G058060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC137-76 aa

PF00069Pkinase91-133 aa

PF07714PK_Tyr_Ser-Thr93-133 aa

PF07714PK_Tyr_Ser-Thr135-310 aa

PF00069Pkinase142-306 aa

PF03109ABC1153-199 aa

PF05445Pox_ser-thr_kin155-174 aa

PF01636APH157-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G058060	`PF03109`	ABC1	37	76	0.15	11.9
TkA06G058060	`PF00069`	Pkinase	91	133	3.2e-32	112.7
TkA06G058060	`PF07714`	PK_Tyr_Ser-Thr	93	133	2.2e-26	93.4
TkA06G058060	`PF07714`	PK_Tyr_Ser-Thr	135	310	2.2e-26	93.4
TkA06G058060	`PF00069`	Pkinase	142	306	3.2e-32	112.7
TkA06G058060	`PF03109`	ABC1	153	199	0.15	11.9
TkA06G058060	`PF05445`	Pox_ser-thr_kin	155	174	0.4	10.3
TkA06G058060	`PF01636`	APH	157	188	0.087	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64477`	Arabidopsis thaliana	sp\|O64477\|Y2913_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130	49.400%	Swiss-Prot	Medium
`Q39203`	Arabidopsis thaliana	sp\|Q39203\|SD22_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2	49.600%	Swiss-Prot	Medium
`Q9FLV4`	Arabidopsis thaliana	sp\|Q9FLV4\|Y5248_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080	46.300%	Swiss-Prot	Medium
`Q8RWZ5`	Arabidopsis thaliana	sp\|Q8RWZ5\|SD25_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5	47.700%	Swiss-Prot	Medium
`Q9XID3`	Arabidopsis thaliana	sp\|Q9XID3\|Y1343_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300	43.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card