RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G057350
Reference: TK1151 Chr: Chr06 Coordinates: 15501927-15505364 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1570 bp · TkA06G057350|TK1151|cDNA

CTGAGAACATTGTATTTATGTTGCCATTAGATCAAATGATCCATTATAAAAACAACGTTTACAAACATGGTTCTATAAGGCCGAGCCCAAACCCGATTAGGTTCAAGCCCGTACTTAGTTTTCCATGTCAAAGTTTCCAAATAATGCCTCAAAATGAACTTGGATGACCATGTTTTTGGGACAAGAATTAAAAAGACTTGTCGAGGCACAAAAAGAAAAAGAGAAATAAAAATAGAAGCACAAATAAGCAAATGCAAGAA...

CDS

Download CDS FASTA

699 bp · TkA06G057350|TK1151|CDS

ATGGTTGGTCCACGAACATGGATTGGAGGAATTTTTGGCATCAAGCGTTCTGAAAGTAACAAATACGCTGATTATAAGTACACTTCAGTTCAGGAAACAAGATACCAGAAGCTTAGAGAACGTACAAATATACCTTTTGATGAAACTCGCATTGAGCACCAGAAAGCCCTTTCGGAATTGTGGAATTTAGCGTATCCAAATGTTACACTTACAAATTTGATCTCTGACCAATGGAAGGAAATGGGATGGCAAGGTGCTAA...

Protein

Download Protein FASTA

232 aa · TkA06G057350|TK1151|PROTEIN

MVGPRTWIGGIFGIKRSESNKYADYKYTSVQETRYQKLRERTNIPFDETRIEHQKALSELWNLAYPNVTLTNLISDQWKEMGWQGANPSTDFRACGFLSLENLLFFAKTFPAAFRRLLLKQPGKRAEWEYPFAIAGVNISFMLTQMLELYSVKPRSLHGVNFVKILGEDDEAFDVLYCIAFAMMDAQWLAMHASYMEFNEVLQITRTQLERELSLDDIHRVRDLPAFNLLHH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G057350
TK1151 IDTkA06G057350
OH-1004 IDLXL04_025476
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 79.181
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G057350
LocationChr06:15501927-15505364 (-)
DescriptionSimilar to elmoA: ELMO domain-containing protein A
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025476 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006909 phagocytosis Biological Process
GO:0007015 actin filament organization Biological Process
GO:0030837 negative regulation of actin filament polymerization Biological Process
GO:0048870 cell motility Biological Process
GO:0050688 regulation of defense response to virus Biological Process
GO:0050764 regulation of phagocytosis Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0032991 protein-containing complex Cellular Component
GO:0005096 GTPase activator activity Molecular Function
GO:0017124 SH3 domain binding Molecular Function
GO:0045159 myosin II binding Molecular Function
KEGG gene cross-reference
bta:515278
ddi:DDB_G0278051
ddi:DDB_G0280179
hsa:79767
mmu:244548
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.624
Rank 1 · TkA06G057350 · TK1151
Nucleus0.295
Rank 2 · TkA06G057350 · TK1151
Golgi apparatus0.141
Rank 3 · TkA06G057350 · TK1151
Cell membrane0.137
Rank 4 · TkA06G057350 · TK1151
Lysosome / Vacuole0.101
Rank 5 · TkA06G057350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04727ELMO_CED1236-202 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G057350PF04727ELMO_CED12362023.1e-52177.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser