TkA06G057110 | RubberDandelionOmics

Gene overview

TkA06G057110

Reference: TK1151 Chr: Chr06 Coordinates: 15398917-15399432 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

516 bp · TkA06G057110|TK1151|cDNA

ATGGCATCTCCCACCTTAATCACTCCCACTACCACCACCCCTAAGCGCCTCCTCCCAATTCGCTCCAAGCTCTCCACACCCAGCTCCCCCTCCACCACCACCACCACCGCCACTACCAATCGCCGAAACTTCTTATCACTGGCTGCCGTAATTTCCATCTCCTCCCCGCTACTTGTTATTCCGGCTGCATTGGCGGCTTCCGATGAAGAATACGCAAAAGAGACCCAGGAGGTTATCCAGAAGGTCAGAAACACGATCAA...

CDS

Download CDS FASTA

516 bp · TkA06G057110|TK1151|CDS

ATGGCATCTCCCACCTTAATCACTCCCACTACCACCACCCCTAAGCGCCTCCTCCCAATTCGCTCCAAGCTCTCCACACCCAGCTCCCCCTCCACCACCACCACCACCGCCACTACCAATCGCCGAAACTTCTTATCACTGGCTGCCGTAATTTCCATCTCCTCCCCGCTACTTGTTATTCCGGCTGCATTGGCGGCTTCCGATGAAGAATACGCAAAAGAGACCCAGGAGGTTATCCAGAAGGTCAGAAACACGATCAA...

Protein

Download Protein FASTA

171 aa · TkA06G057110|TK1151|PROTEIN

MASPTLITPTTTTPKRLLPIRSKLSTPSSPSTTTTTATTNRRNFLSLAAVISISSPLLVIPAALAASDEEYAKETQEVIQKVRNTINMDKTDPNIAAAVAELRETSNSWVAKYRREKALLGRISFRDMYSALNAVSGHYVSFGPTSPIPAKRKTRILEEMDSVEKALSRGR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G057110`
TK1151 ID	TkA06G057110
OH-1004 ID	LXL04_025479
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.900
Protein coverage (%)	TK1151 100.000 / OH-1004 93.923 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G057110

Location Chr06:15398917-15399432 (+)

Description Similar to PSB27-1: Photosystem II repair protein PSB27-H1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03600`	Probably involved in repair of photodamaged photosystem II (PSII).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025479 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010206 photosystem II repair Biological Process

GO:0010207 photosystem II assembly Biological Process

GO:0071484 cellular response to light intensity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009523 photosystem II Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

KEGG gene cross-reference

ath:AT1G03600

syn:slr1645

tel:tll2464

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · TkA06G057110 · TK1151

Mitochondrion0.021

Rank 2 · TkA06G057110 · TK1151

Nucleus0.012

Rank 3 · TkA06G057110 · TK1151

Cytoplasm0.008

Rank 4 · TkA06G057110 · TK1151

Cell membrane0.007

Rank 5 · TkA06G057110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03566Peptidase_A2127-108 aa

PF27358HrpD632-46 aa

PF13326PSII_Pbs2741-167 aa

PF07015VirC147-91 aa

PF17015DUF509448-120 aa

PF27358HrpD678-134 aa

PF18460HetR_C82-116 aa

PF18460HetR_C152-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G057110	`PF03566`	Peptidase_A21	27	108	0.012	14.6
TkA06G057110	`PF27358`	HrpD6	32	46	0.0056	17.7
TkA06G057110	`PF13326`	PSII_Pbs27	41	167	4.7e-34	118.4
TkA06G057110	`PF07015`	VirC1	47	91	0.094	12.8
TkA06G057110	`PF17015`	DUF5094	48	120	0.21	12.4
TkA06G057110	`PF27358`	HrpD6	78	134	0.0056	17.7
TkA06G057110	`PF18460`	HetR_C	82	116	0.059	14.0
TkA06G057110	`PF18460`	HetR_C	152	167	0.059	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LR64`	Arabidopsis thaliana	sp\|Q9LR64\|PB27A_ARATH Photosystem II repair protein PSB27-H1, chloroplastic	70.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card