TkA06G056750 | RubberDandelionOmics

Gene overview

TkA06G056750

Reference: TK1151 Chr: Chr06 Coordinates: 15292821-15297292 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2550 bp · TkA06G056750|TK1151|cDNA

CTAGCATCCAATATTTTGCAGGCTTCAATGTCACTGTTGTCTATTTAGCTCCAATTATTTATTGGAAACGATAACGACAGTATGGTATAAAGTTTTCTTGACGTGTAAGAACAAACAGAGAAATTAATCAAGATCCCCGACAATGGAAACAACGACTTCAAGCGAAAATATGATCGGGTGGTTCGAAGAAATAGCGAAGAACGCTGGGAAAGTTCAGAGGGAAACATTGAAAAAGATTCTTGAAATGAATCATGGAGTTG...

CDS

Download CDS FASTA

1314 bp · TkA06G056750|TK1151|CDS

ATGGAAACAACGACTTCAAGCGAAAATATGATCGGGTGGTTCGAAGAAATAGCGAAGAACGCTGGGAAAGTTCAGAGGGAAACATTGAAAAAGATTCTTGAAATGAATCATGGAGTTGAATATTTGAAGAAATGGTTGGGTGATATCGATGTTGATAAGATGGAAGATGAAGCATTGCAGTCGCTTTACACATCAATGGTGCCATTAGCTTCTCATGCAGATTTAGAACCCTATATTCAGAGGATTGCCGATGGAGAAAC...

Protein

Download Protein FASTA

438 aa · TkA06G056750|TK1151|PROTEIN

METTTSSENMIGWFEEIAKNAGKVQRETLKKILEMNHGVEYLKKWLGDIDVDKMEDEALQSLYTSMVPLASHADLEPYIQRIADGETCPLLTKQPITTLSLSSGTTEGRQKYVPFTSHSSKTTLQIFKLASAYRSRVYPTREGGKILEFIYSSKQFKTKGGLCAGTATTHYFASQEFKLKQQQTNTFTCSPEEVISGGDYKQSTYCHFLLGLFHSRDVEFITSTFAFCIVQALNLFEDYWKELCDDLSNGTLSPRITIPC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G056750`
TK1151 ID	TkA06G056750
OH-1004 ID	LXL04_025483
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 94.977 / OH-1004 70.034 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G056750

Location Chr06:15292821-15297292 (-)

Description Similar to GH3.10: Indole-3-acetic acid-amido synthetase GH3.10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03400`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin (By similarity).	DFL2, a new member of the Arabidopsis GH3 gene family, is involved in red light-specific hypocotyl elongation.2003 · DOI: 10.1093/pcp/pcg130

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0586200`	Catalyzes the synthesis of jasmonate-amino acid conjugates by adenylation.	Rice JASMONATE RESISTANT 1 is involved in phytochrome and jasmonate signalling.2008 · DOI: 10.1111/j.1365-3040.2008.01790.x OsJAR1 and OsJAR2 are jasmonyl-L-isoleucine synthases involved in wound- and pathogen-induced jasmonic acid signalling.2011 · DOI: 10.1016/j.bbrc.2011.05.055 Response of rice to insect elicitors and the role of OsJAR1 in wound and herbivory-induced JA-Ile accumulation.2013 · DOI: 10.1111/jipb.12057 OsJAR1 contributes mainly to biosynthesis of the stress-induced jasmonoyl-isoleucine involved in defense responses in rice.2013 · DOI: 10.1271/bbb.130272 Light induces jasmonate-isoleucine conjugation via OsJAR1-dependent and -independent pathways in rice.2014 · DOI: 10.1111/pce.12201 OsJAR1 is required for JA-regulated floret opening and anther dehiscence in rice.2014 · DOI: 10.1007/s11103-014-0212-y
`Os01g0221100`	Catalyzes the synthesis of jasmonate-amino acid conjugates by adenylation.	OsJAR1 and OsJAR2 are jasmonyl-L-isoleucine synthases involved in wound- and pathogen-induced jasmonic acid signalling.2011 · DOI: 10.1016/j.bbrc.2011.05.055 Light induces jasmonate-isoleucine conjugation via OsJAR1-dependent and -independent pathways in rice.2014 · DOI: 10.1111/pce.12201

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025483 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009694 jasmonic acid metabolic process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0010046 response to mycotoxin Biological Process

GO:0010119 regulation of stomatal movement Biological Process

KEGG gene cross-reference

ath:AT2G46370

ath:AT4G03400

dosa:Os05g0586200

nau:109207440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.400

Rank 1 · TkA06G056750 · TK1151

Nucleus0.372

Rank 2 · TkA06G056750 · TK1151

Mitochondrion0.128

Rank 3 · TkA06G056750 · TK1151

Peroxisome0.069

Rank 4 · TkA06G056750 · TK1151

Plastid0.062

Rank 5 · TkA06G056750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03321GH311-329 aa

PF23571GH3_M182-200 aa

PF23571GH3_M357-415 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G056750	`PF03321`	GH3	11	329	3e-101	339.3
TkA06G056750	`PF23571`	GH3_M	182	200	7e-09	36.3
TkA06G056750	`PF23571`	GH3_M	357	415	7e-09	36.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZNS2`	Arabidopsis thaliana	sp\|Q9ZNS2\|GH310_ARATH Indole-3-acetic acid-amido synthetase GH3.10	64.700%	Swiss-Prot	High
`Q6I581`	Oryza sativa subsp. japonica	sp\|Q6I581\|GH35_ORYSJ Jasmonoyl--L-amino acid synthetase GH3.5	48.100%	Swiss-Prot	Medium
`Q5NAZ7`	Oryza sativa subsp. japonica	sp\|Q5NAZ7\|GH33_ORYSJ Jasmonoyl--L-amino acid synthetase GH3.3	47.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card