TkA06G056490 | RubberDandelionOmics

Gene overview

TkA06G056490

Reference: TK1151 Chr: Chr06 Coordinates: 15247124-15250444 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2988 bp · TkA06G056490|TK1151|cDNA

TTTCAAAGTTACACCCATGTACCAAATCTAACTATCTCTTAATAGATATAGAAACTGATTTTTTGTTTGAAATCTTGAAATAAATCCATATCTATTAGAAGAACAAGAGTGTGGGCTATTGTATCATAACCCCCTGCCTAATATGGAACGCTGAAAGAAGCCATGGATCCGCCGGAGTTACCTGAGTGTCCAGTCTGCCTCCAGCCCTTCGACGGCGAATCCACAACCCCACGCGTCCTCGCCTGCGGTCACTCTACCTG...

CDS

Download CDS FASTA

2460 bp · TkA06G056490|TK1151|CDS

ATGGATCCGCCGGAGTTACCTGAGTGTCCAGTCTGCCTCCAGCCCTTCGACGGCGAATCCACAACCCCACGCGTCCTCGCCTGCGGTCACTCTACCTGCGAAACATGCATGATCGACCTTCCAAAACCACCTTTCCCTCGTACTATACGCTGCCCGGCTTGTACCCAGCTTGTCCCCTACCCACCACAAGGTCCCTCCGCCCTCCCCAAAAACATCGACCTACTCCGCATCTCCTCCTCTCTTCTTCAATCAAACCCCAA...

Protein

Download Protein FASTA

819 aa · TkA06G056490|TK1151|PROTEIN

MDPPELPECPVCLQPFDGESTTPRVLACGHSTCETCMIDLPKPPFPRTIRCPACTQLVPYPPQGPSALPKNIDLLRISSSLLQSNPNRLNSKPKTSIVSSPDFIPNLWSREFYCNWKPWIVPRDTVSVDMSVALDEAFLLGTVVNPDASSGEVSSRCSMEIHQKVSLFKIGSFTHSNENRFSYSCLAKAISILFKMSDGALAELTLILTSSSMEYRICTSYGLWYNEVNEHLYIVCGKKQSSLLNAIVSDIHLQDDISTF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G056490`
TK1151 ID	TkA06G056490
OH-1004 ID	LXL04_025490
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G056490

Location Chr06:15247124-15250444 (-)

Description Similar to lin-23: F-box/WD repeat-containing protein lin-23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16750`	Essential protein involved in the regulation of cell division planes during embryogenesis which defines cell patterning, especially longitudinal division planes of the proembryo, probably via the regulation of embryo patterning genes expression patterns.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025490 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006508 proteolysis Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0010826 negative regulation of centrosome duplication Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0051301 cell division Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0061136 regulation of proteasomal protein catabolic process Biological Process

KEGG gene cross-reference

ana:alr3466

cel:CELE_K10B2.1

dre:334373

dre:406825

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.558

Rank 1 · TkA06G056490 · TK1151

Cytoplasm0.371

Rank 2 · TkA06G056490 · TK1151

Cell membrane0.090

Rank 3 · TkA06G056490 · TK1151

Endoplasmic reticulum0.052

Rank 4 · TkA06G056490 · TK1151

Lysosome / Vacuole0.048

Rank 5 · TkA06G056490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22910EDR4-like_1st4-12 aa

PF14634zf-RING_58-55 aa

PF13639zf-RING_28-54 aa

PF13923zf-C3HC4_28-54 aa

PF17123zf-RING_118-30 aa

PF13445zf-RING_UBOX9-52 aa

PF00097zf-C3HC49-54 aa

PF15227zf-C3HC4_49-54 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G056490	`PF22910`	EDR4-like_1st	4	12	8.2	6.8
TkA06G056490	`PF14634`	zf-RING_5	8	55	5.6e-06	26.9
TkA06G056490	`PF13639`	zf-RING_2	8	54	5.7e-05	24.0
TkA06G056490	`PF13923`	zf-C3HC4_2	8	54	0.012	16.1
TkA06G056490	`PF17123`	zf-RING_11	8	30	0.024	15.1
TkA06G056490	`PF13445`	zf-RING_UBOX	9	52	1.2e-06	29.1
TkA06G056490	`PF00097`	zf-C3HC4	9	54	0.0011	19.5
TkA06G056490	`PF15227`	zf-C3HC4_4	9	54	0.044	14.6
TkA06G056490	`PF21362`	Sina_RING	9	42	1.8	9.5
TkA06G056490	`PF14570`	zf-RING_4	9	55	7.0	7.2
TkA06G056490	`PF21363`	TRAF3_RING	23	46	0.28	11.7
TkA06G056490	`PF22910`	EDR4-like_1st	47	62	8.2	6.8
TkA06G056490	`PF21362`	Sina_RING	51	58	1.8	9.5
TkA06G056490	`PF21363`	TRAF3_RING	180	190	0.28	11.7
TkA06G056490	`PF00069`	Pkinase	199	279	7.4e-07	29.5
TkA06G056490	`PF23414`	Beta-prop_EML_2	312	338	4.8e-10	40.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFE2`	Arabidopsis thaliana	sp\|Q9LFE2\|TOZ_ARATH Protein TORMOZ EMBRYO DEFECTIVE	26.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card