TkA06G056460 | RubberDandelionOmics

Gene overview

TkA06G056460

Reference: TK1151 Chr: Chr06 Coordinates: 15240540-15242921 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1076 bp · TkA06G056460|TK1151|cDNA

GAATTATTTCCTACCAAAACAAACAGACTTCAATCCTATTCAATTATCCAATTTCTTCGAATATTGATTTCAAACAACATTGCACGGAATCATAAATTCTAGAATCAGCTTCTGGTTTTCATCCAATGGGCGGCCGTAACGATCCTAACGAGAATCCTACTGCAAACTCAAAATCATCGACACTTCCCCCAAATCGTGATATTGAATCTAATACGACCGTTGATATCCCTTCTCATAACACCAAGGATATGAAAGCCAAG...

CDS

Download CDS FASTA

816 bp · TkA06G056460|TK1151|CDS

ATGGGCGGCCGTAACGATCCTAACGAGAATCCTACTGCAAACTCAAAATCATCGACACTTCCCCCAAATCGTGATATTGAATCTAATACGACCGTTGATATCCCTTCTCATAACACCAAGGATATGAAAGCCAAGGAAAAAGAACTCCAGGATAAAGAAGCCGAATTAAAAAAGAAGGAAGAGGATCTACGGAAGAGAGAAGCGGCAATTGCACGATCTGGAGTTGTTATTGATGATAACAATTGGCCACCCTTTTACCC...

Protein

Download Protein FASTA

271 aa · TkA06G056460|TK1151|PROTEIN

MGGRNDPNENPTANSKSSTLPPNRDIESNTTVDIPSHNTKDMKAKEKELQDKEAELKKKEEDLRKREAAIARSGVVIDDNNWPPFYPIIHHDIKSEIPIHLQKVQYVAFGSWLGIMLCLVWNLVAVSVAWYEGEGVTIWLCAVIYVILGIPLSYYLWYRPLYRAMRADSAVKFTFFLITYSFHISFCAFASLAPPIFIEGKSIAGILPAFDLLVGNAALGGLYLVGFGLFFIETAISIWVIQQVYSYFRGSGKAAEMKRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G056460`
TK1151 ID	TkA06G056460
OH-1004 ID	LXL04_025491
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 97.048 / OH-1004 20.563 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G056460

Location Chr06:15240540-15242921 (-)

Description Similar to At1g73710: Pentatricopeptide repeat-containing protein At1g73710

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20840`	Probably involved in membrane trafficking.	No verified direct reference in this release
`At1g03550`	Probably involved in membrane trafficking.	No verified direct reference in this release
`At1g61250`	Probably involved in membrane trafficking.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YMP7`	Probably involved in membrane trafficking.	No verified direct reference in this release
`Os07g0564600`	Probably involved in membrane trafficking.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025491 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010343 singlet oxygen-mediated programmed cell death Biological Process

GO:0015031 protein transport Biological Process

GO:1904821 chloroplast disassembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030658 transport vesicle membrane Cellular Component

GO:0032588 trans-Golgi network membrane Cellular Component

GO:0055038 recycling endosome membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G73710

ath:AT3G23020

dosa:Os07g0564600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.334

Rank 1 · TkA06G056460 · TK1151

Cell membrane0.328

Rank 2 · TkA06G056460 · TK1151

Golgi apparatus0.282

Rank 3 · TkA06G056460 · TK1151

Endoplasmic reticulum0.165

Rank 4 · TkA06G056460 · TK1151

Lysosome / Vacuole0.151

Rank 5 · TkA06G056460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12072RNase_Y_N40-71 aa

PF04977DivIC40-72 aa

PF04144SCAMP80-250 aa

PF14012DUF4229116-157 aa

PF14012DUF4229227-241 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G056460	`PF12072`	RNase_Y_N	40	71	0.013	15.7
TkA06G056460	`PF04977`	DivIC	40	72	2.1	8.9
TkA06G056460	`PF04144`	SCAMP	80	250	5.6e-52	177.1
TkA06G056460	`PF14012`	DUF4229	116	157	2.7	8.8
TkA06G056460	`PF14012`	DUF4229	227	241	2.7	8.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKT3`	Arabidopsis thaliana	sp\|Q9SKT3\|SCAM1_ARATH Secretory carrier-associated membrane protein 1	64.900%	Swiss-Prot	High
`Q9LR68`	Arabidopsis thaliana	sp\|Q9LR68\|SCAM2_ARATH Secretory carrier-associated membrane protein 2	62.900%	Swiss-Prot	High
`Q9M5P2`	Arabidopsis thaliana	sp\|Q9M5P2\|SCAM3_ARATH Secretory carrier-associated membrane protein 3	63.100%	Swiss-Prot	High
`A2YMP7`	Oryza sativa subsp. indica	sp\|A2YMP7\|SCAM1_ORYSI Putative secretory carrier-associated membrane protein 1	63.400%	Swiss-Prot	High
`Q8H5X5`	Oryza sativa subsp. japonica	sp\|Q8H5X5\|SCAM1_ORYSJ Secretory carrier-associated membrane protein 1	63.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card