Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2978 bp · TkA06G056450|TK1151|cDNA
CTGGAACCTGCAAGCGGAAAAGGCCGCCATAATGCTTCAAACTTGCAGTTACAGAGAAGTAAGCCGCGAAAATATGCACAGCTCACAAAATCTACAAGCTGTTTCTCCGCCATAGTGTTTAGCCACCACCGCTACTAATACCATCAGAAACAGCGTAAGTAATCACGGTTCTAACCATAAGAAGAATAAAAAGAGATATGGAGGTCTATTGCCTTCGATTTTAAAGTCTTTGGATTCCGATTCAGACGACGATGTTGATA...
2535 bp · TkA06G056450|TK1151|CDS
ATGAAATCACAGCCGGAGTATTCCCCAAATGTGATTCACTACAACGTTGTTCTTCGTGCCCTTGGTCGTGCCAGGAAATGGGATGAATTAAGACGTTGCTGGATCGACATGGCTAAAAAAGGTGTTTTCCCTACTAATAACACATACGGAATGCTTGTTGACGTGTACGGGAAAGCAGGTCTTGTGAAAGAAGCTCTTTTGTGGATTAAACACATGAAACTTAGAGGCATCTTTCCAGATGAAGTCACCATGAATACAAT...
Protein
Download Protein FASTA844 aa · TkA06G056450|TK1151|PROTEIN
MKSQPEYSPNVIHYNVVLRALGRARKWDELRRCWIDMAKKGVFPTNNTYGMLVDVYGKAGLVKEALLWIKHMKLRGIFPDEVTMNTMVRVLKDGGEYDRADRFYKDWCVGKVELNDLEFDSDSETSSSSEPISLTQFLLTELFRTGGRESRDHTKSTLTENSIQKPRLTATYNTLIDLYGKAGRLKDAGDVFAEMLQSGIAMDTITFNTMIFTCGSHGNISEAESLFHKMEERGIPPDTKTYNIFLSLYAAMGDIDEALK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G056450 |
|---|---|
| TK1151 ID | TkA06G056450 |
| OH-1004 ID | LXL04_025491 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 99.200 |
| Protein coverage (%) | TK1151 99.882 / OH-1004 65.911Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G056450 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:15237242-15240348 (-) | |||||||||
| Description | Similar to At1g73710: Pentatricopeptide repeat-containing protein At1g73710 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006355 regulation of DNA-templated transcription Biological Process GO:0010343 singlet oxygen-mediated programmed cell death Biological Process GO:0015031 protein transport Biological Process GO:1904821 chloroplast disassembly Biological Process GO:0005739 mitochondrion Cellular Component GO:0005769 early endosome Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0030658 transport vesicle membrane Cellular Component GO:0032588 trans-Golgi network membrane Cellular Component GO:0055038 recycling endosome membrane Cellular Component GO:0003729 mRNA binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G73710 ath:AT3G23020 dosa:Os07g0564600 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12854PPR_17-29 aaPF29070MSC6_N8-65 aaPF17177PPR_long8-104 aaPF13041PPR_29-56 aaPF13812PPR_39-58 aaPF23276TPR_2410-48 aaPF01535PPR13-42 aaPF26719TPR_Atp25_C13-54 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G056450 | PF12854 | PPR_1 | 7 | 29 | 1.4e-70 | 233.4 |
| TkA06G056450 | PF29070 | MSC6_N | 8 | 65 | 5.9e-38 | 131.7 |
| TkA06G056450 | PF17177 | PPR_long | 8 | 104 | 5.5e-36 | 124.7 |
| TkA06G056450 | PF13041 | PPR_2 | 9 | 56 | 7.5e-111 | 362.9 |
| TkA06G056450 | PF13812 | PPR_3 | 9 | 58 | 1.1e-56 | 189.5 |
| TkA06G056450 | PF23276 | TPR_24 | 10 | 48 | 1.2e-40 | 139.2 |
| TkA06G056450 | PF01535 | PPR | 13 | 42 | 9.9e-91 | 292.6 |
| TkA06G056450 | PF26719 | TPR_Atp25_C | 13 | 54 | 0.00026 | 21.0 |
| TkA06G056450 | PF08579 | RPM2 | 27 | 54 | 0.00057 | 21.0 |
| TkA06G056450 | PF06239 | ECSIT_N | 36 | 61 | 0.019 | 15.0 |
| TkA06G056450 | PF10037 | MRP-S27 | 38 | 83 | 0.00063 | 19.5 |
| TkA06G056450 | PF12854 | PPR_1 | 40 | 66 | 1.4e-70 | 233.4 |
| TkA06G056450 | PF23276 | TPR_24 | 47 | 93 | 1.2e-40 | 139.2 |
| TkA06G056450 | PF13041 | PPR_2 | 48 | 91 | 7.5e-111 | 362.9 |
| TkA06G056450 | PF01535 | PPR | 48 | 77 | 9.9e-91 | 292.6 |
| TkA06G056450 | PF20431 | E_motif | 48 | 77 | 0.17 | 12.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.