RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G056220
Reference: TK1151 Chr: Chr06 Coordinates: 15161510-15164722 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1905 bp · TkA06G056220|TK1151|cDNA

ATGTCCGCCAGAGCGTTGAGGAAGGTGCTTAACGAACAAGAATCAGCAAAGAATCAAGACATCATATTATCTGCCGATGAAGAGTCGGAATCGCCCTCCGATTCACCCCGCCCCTCTTCTATTAATCCCTTCGATCTCCTCAACGAACAGGAGGAGCAGGAGCAGGAACAGTTGCAGGAGGATGACTCAAGTGATGTTGATACTTCCTCTTCTATAAAAACCGAAAACAATGTACTCACAACCAAGAAAAACACTCCTAC...

CDS

Download CDS FASTA

1905 bp · TkA06G056220|TK1151|CDS

ATGTCCGCCAGAGCGTTGAGGAAGGTGCTTAACGAACAAGAATCAGCAAAGAATCAAGACATCATATTATCTGCCGATGAAGAGTCGGAATCGCCCTCCGATTCACCCCGCCCCTCTTCTATTAATCCCTTCGATCTCCTCAACGAACAGGAGGAGCAGGAGCAGGAACAGTTGCAGGAGGATGACTCAAGTGATGTTGATACTTCCTCTTCTATAAAAACCGAAAACAATGTACTCACAACCAAGAAAAACACTCCTAC...

Protein

Download Protein FASTA

634 aa · TkA06G056220|TK1151|PROTEIN

MSARALRKVLNEQESAKNQDIILSADEESESPSDSPRPSSINPFDLLNEQEEQEQEQLQEDDSSDVDTSSSIKTENNVLTTKKNTPTTTLPSTQKSKKKKKKKKTKELSSTTNTTDSLDAILDLSFGVNGQSQTCSSKKKSENPNDKPVKVSTVTTNILQIDPKFLSAENELRRIFGSKVVSSFERSNNNNNQQPGSSRTQNRLGRRGGAHTHRKTIIVTPSDHWARWDGSLSMELLENKDGSSYFRYVHSTTYSLAQRQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G056220
TK1151 IDTkA06G056220
OH-1004 IDLXL04_025503
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)94.200
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G056220
LocationChr06:15161510-15164722 (-)
DescriptionSimilar to TCF25: Transcription factor 25
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025503 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0061945 regulation of protein K48-linked ubiquitination Biological Process
GO:0072344 rescue of stalled cytosolic ribosome Biological Process
GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process Biological Process
GO:0005634 nucleus Cellular Component
GO:0005829 cytosol Cellular Component
GO:0071944 cell periphery Cellular Component
GO:1990112 RQC complex Cellular Component
GO:0003677 DNA binding Molecular Function
GO:0003714 transcription corepressor activity Molecular Function
KEGG gene cross-reference
ddi:DDB_G0274217
hsa:22980
mmu:66855
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.754
Rank 1 · TkA06G056220 · TK1151
Cytoplasm0.333
Rank 2 · TkA06G056220 · TK1151
Endoplasmic reticulum0.025
Rank 3 · TkA06G056220 · TK1151
Golgi apparatus0.021
Rank 4 · TkA06G056220 · TK1151
Mitochondrion0.020
Rank 5 · TkA06G056220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09598Stm1_N40-102 aa
PF05327RRN348-141 aa
PF08158SDA1_HEAT50-107 aa
PF08158SDA1_HEAT166-203 aa
PF04910Tcf25246-567 aa
PF08158SDA1_HEAT266-293 aa
PF05327RRN3314-351 aa
PF08158SDA1_HEAT326-356 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G056220PF09598Stm1_N401022.49.7
TkA06G056220PF05327RRN3481414.66.4
TkA06G056220PF08158SDA1_HEAT501072.67.6
TkA06G056220PF08158SDA1_HEAT1662032.67.6
TkA06G056220PF04910Tcf252465672.1e-73248.1
TkA06G056220PF08158SDA1_HEAT2662932.67.6
TkA06G056220PF05327RRN33143514.66.4
TkA06G056220PF08158SDA1_HEAT3263562.67.6
TkA06G056220PF08158SDA1_HEAT4184432.67.6
TkA06G056220PF05327RRN34444854.66.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser