TkA06G051260 | RubberDandelionOmics

Gene overview

TkA06G051260

Reference: TK1151 Chr: Chr06 Coordinates: 13912439-13919138 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3521 bp · TkA06G051260|TK1151|cDNA

ATGAAAAAGAAGAAGAACAATTTTTCAATAAGGGAATTAAAGAAACGGCTGAAAGAAACCTTAAGTAAGAGCCCCACACCAGTAAAGATAAAGATAAAAAATGAGGAAAAGATTGATGAAAAAGAAGGTGGAGGGGATGACAAGAAGGCTAAGAGTTTAAATGATGCAAGGAGTATGAGGCAGCTGAAGAAGCAGCTGAAAAAAGCCTTATCGGGACAATTGGGAGTCAAACCACAGATGGTTGGCAATATTGATGGCAA...

CDS

Download CDS FASTA

1251 bp · TkA06G051260|TK1151|CDS

ATGAAAAAGAAGAAGAACAATTTTTCAATAAGGGAATTAAAGAAACGGCTGAAAGAAACCTTAAGTAAGAGCCCCACACCAGTAAAGATAAAGATAAAAAATGAGGAAAAGATTGATGAAAAAGAAGGTGGAGGGGATGACAAGAAGGCTAAGAGTTTAAATGATGCAAGGAGTATGAGGCAGCTGAAGAAGCAGCTGAAAAAAGCCTTATCGGGACAATTGGGAGTCAAACCACAGATGGTTGGCAATATTGATGGCAA...

Protein

Download Protein FASTA

416 aa · TkA06G051260|TK1151|PROTEIN

MKKKKNNFSIRELKKRLKETLSKSPTPVKIKIKNEEKIDEKEGGGDDKKAKSLNDARSMRQLKKQLKKALSGQLGVKPQMVGNIDGNGGEGSTSIPRPSPLSPQPSSIQPTHDPLPGHSLATGGEISTSHPPSKPPISPLHPQSSSISASHDSPCVHLGTGGEDSSSHPPSQPPLSPIAPELSSITANNDTPPVHFGTDGEGSTSHSPSKPPQSLLPQPPSSITANHDTPAVHFGQISRRRSPRLLDCNNGGTDSSFDIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G051260`
TK1151 ID	TkA06G051260
OH-1004 ID	LXL04_025565
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.400
Protein coverage (%)	TK1151 81.010 / OH-1004 25.668 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G051260

Location Chr06:13912439-13919138 (+)

Description Similar to CMT2: DNA (cytosine-5)-methyltransferase CMT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19020`	May be involved in the CpXpG methylation and in gene silencing.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q5KQL9`	Involved in CpXpG DNA methylation.	No verified direct reference in this release
`Os03g0226800`	Involved in CpXpG DNA methylation (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025565 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0032259 methylation Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0044027 negative regulation of gene expression via chromosomal CpG island methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0003886 DNA (cytosine-5-)-methyltransferase activity Molecular Function

GO:0032183 SUMO binding Molecular Function

KEGG gene cross-reference

ath:AT4G19020

dosa:Os03g0226800

dosa:Os05g0224800

dosa:Os05g0224900

osa:4338140

zma:542060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.948

Rank 1 · TkA06G051260 · TK1151

Cytoplasm0.097

Rank 2 · TkA06G051260 · TK1151

Cell membrane0.036

Rank 3 · TkA06G051260 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkA06G051260 · TK1151

Plastid0.012

Rank 5 · TkA06G051260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01426BAH346-415 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G051260	`PF01426`	BAH	346	415	3.1e-08	34.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94F87`	Arabidopsis thaliana	sp\|Q94F87\|CMT2_ARATH DNA (cytosine-5)-methyltransferase CMT2	42.200%	Swiss-Prot	Low
`Q5KQL9`	Oryza sativa subsp. japonica	sp\|Q5KQL9\|CMT2_ORYSJ DNA (cytosine-5)-methyltransferase CMT2	48.900%	Swiss-Prot	Low
`A0A0P0VUY4`	Oryza sativa subsp. japonica	sp\|A0A0P0VUY4\|CMT1_ORYSJ DNA (cytosine-5)-methyltransferase CMT1	31.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card