TkA06G050110 | RubberDandelionOmics

Gene overview

TkA06G050110

Reference: TK1151 Chr: Chr06 Coordinates: 13671174-13671568 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

303 bp · TkA06G050110|TK1151|cDNA

ATGCTTATTCTTCTCCTATTCATCGTCCTGTTAACATGCCACCCCCATCACGTCTCCACCACCAACCACCTGCAACCATCCGACACCATGGATCCATCGGAGCTACAAACTCTGTACACTATCATGGAAACTCTCTCTCTAGACCAAAAATGGAGACTCAGCTATCCAAACCCATGTAAACCTTCCGCTTCTTGGGTTGGAATAGAATGCAAACGAGGTGTTACAGACTCTCATCTTCATGTCACTAGGCTTAATTTCGT...

CDS

Download CDS FASTA

303 bp · TkA06G050110|TK1151|CDS

ATGCTTATTCTTCTCCTATTCATCGTCCTGTTAACATGCCACCCCCATCACGTCTCCACCACCAACCACCTGCAACCATCCGACACCATGGATCCATCGGAGCTACAAACTCTGTACACTATCATGGAAACTCTCTCTCTAGACCAAAAATGGAGACTCAGCTATCCAAACCCATGTAAACCTTCCGCTTCTTGGGTTGGAATAGAATGCAAACGAGGTGTTACAGACTCTCATCTTCATGTCACTAGGCTTAATTTCGT...

Protein

Download Protein FASTA

100 aa · TkA06G050110|TK1151|PROTEIN

MLILLLFIVLLTCHPHHVSTTNHLQPSDTMDPSELQTLYTIMETLSLDQKWRLSYPNPCKPSASWVGIECKRGVTDSHLHVTRLNFVFHHNQNDDFCVED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G050110`
TK1151 ID	TkA06G050110
OH-1004 ID	LXL04_025585
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 57.000 / OH-1004 13.443 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G050110

Location Chr06:13671174-13671568 (+)

Description Similar to RLP29: Receptor like protein 29

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42800`	Receptor like protein 29.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025585 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0008356 asymmetric cell division Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009620 response to fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0010376 stomatal complex formation Biological Process

KEGG gene cross-reference

ath:AT1G13230

ath:AT1G80080

ath:AT2G42800

ath:AT4G28650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.288

Rank 1 · TkA06G050110 · TK1151

Endoplasmic reticulum0.231

Rank 2 · TkA06G050110 · TK1151

Extracellular0.218

Rank 3 · TkA06G050110 · TK1151

Lysosome / Vacuole0.146

Rank 4 · TkA06G050110 · TK1151

Cytoplasm0.144

Rank 5 · TkA06G050110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_250-70 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G050110	`PF08263`	LRRNT_2	50	70	0.045	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJH6`	Arabidopsis thaliana	sp\|Q9SJH6\|RLP29_ARATH Receptor like protein 29	50.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card