TkA06G049230 | RubberDandelionOmics

Gene overview

TkA06G049230

Reference: TK1151 Chr: Chr06 Coordinates: 13322060-13322593 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

534 bp · TkA06G049230|TK1151|cDNA

ATGGCTCGACCCCTAGCCCTAGCTTCCCAAGGGGATGATGAAGTAATTGGTACAAAAGGAGTTAAAAAAGTGGAATTTGTCCGAATTATAGCTGAAGCATTATACTCTCTTGGATACAGTAAAACAGGTGCATGTCTTGAAGAAGAATCAGGAATCCCTTTTCACTCATCACAGTCACTGATTTCATCCAACAAGTTCTTAATGGAAATTGGACGGAAGTTTTCTTCTTTACACAAAATCGGCATAATTGAAGACTCTAT...

CDS

Download CDS FASTA

534 bp · TkA06G049230|TK1151|CDS

ATGGCTCGACCCCTAGCCCTAGCTTCCCAAGGGGATGATGAAGTAATTGGTACAAAAGGAGTTAAAAAAGTGGAATTTGTCCGAATTATAGCTGAAGCATTATACTCTCTTGGATACAGTAAAACAGGTGCATGTCTTGAAGAAGAATCAGGAATCCCTTTTCACTCATCACAGTCACTGATTTCATCCAACAAGTTCTTAATGGAAATTGGACGGAAGTTTTCTTCTTTACACAAAATCGGCATAATTGAAGACTCTAT...

Protein

Download Protein FASTA

177 aa · TkA06G049230|TK1151|PROTEIN

MARPLALASQGDDEVIGTKGVKKVEFVRIIAEALYSLGYSKTGACLEEESGIPFHSSQSLISSNKFLMEIGRKFSSLHKIGIIEDSIIKSASFMILQQKFFELLDHGKVNGSFETLRTEISPLEINSNRVRELSSFILSPTHKTINGVSSQESLKLNQGHNYLRICKNVPSNSYDTR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G049230`
TK1151 ID	TkA06G049230
OH-1004 ID	LXL04_025612
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.200
Protein coverage (%)	TK1151 88.136 / OH-1004 26.610 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G049230

Location Chr06:13322060-13322593 (+)

Description Similar to WDR26: WD repeat-containing protein 26 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08560`	Acts as a component involved in the crosstalk regulation between light, hormone and abiotic stress response.	An Arabidopsis WDR protein coordinates cellular networks involved in light, stress response and hormone signals.2015 · DOI: 10.1016/j.plantsci.2015.09.024
`At5g43920`	WD repeat-containing protein WDS homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025612 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G08560

ath:AT5G43920

hsa:80232

xtr:733878

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.535

Rank 1 · TkA06G049230 · TK1151

Nucleus0.501

Rank 2 · TkA06G049230 · TK1151

Mitochondrion0.055

Rank 3 · TkA06G049230 · TK1151

Peroxisome0.045

Rank 4 · TkA06G049230 · TK1151

Cell membrane0.042

Rank 5 · TkA06G049230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23627LisH_WDR2614-56 aa

PF24951LisH_PAC134-53 aa

PF24951LisH_PAC1112-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G049230	`PF23627`	LisH_WDR26	14	56	6.4e-20	71.0
TkA06G049230	`PF24951`	LisH_PAC1	34	53	0.071	13.6
TkA06G049230	`PF24951`	LisH_PAC1	112	120	0.071	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNN2`	Arabidopsis thaliana	sp\|Q9FNN2\|WDR26_ARATH WD repeat-containing protein 26 homolog	51.000%	Swiss-Prot	High
`Q9FND4`	Arabidopsis thaliana	sp\|Q9FND4\|WDS_ARATH WD repeat-containing protein WDS homolog	30.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card