TkA06G048740 | RubberDandelionOmics

Gene overview

TkA06G048740

Reference: TK1151 Chr: Chr06 Coordinates: 13215810-13219143 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2899 bp · TkA06G048740|TK1151|cDNA

CGAAAACCGGTCCAGTTTTTAGATCCTATTTTTCAAAAATTCAGGATTTAGGTTTCCGGATATCGAACCGATCCGAGTTTTATCCGATGCTCATCCCTACTTTCAACTACCGGTTAGAAGCTTCAAACTTAAAGTTAGGAGCTATAAATTAGAAGTTTTTTATTTAATGGCGTTATACAATTTTATAGCTACAGTTAAATATAATTTCCAAAACGTAATAATAAATACCAAAATGGTTTTGTAAAGAAACAATATATAAG...

CDS

Download CDS FASTA

1233 bp · TkA06G048740|TK1151|CDS

ATGGGTTCGTTGTCCGGTTTATTTCAAAGACCGGTTGTTGCCGCCTCTGCTGTCGCATTAGCTTCCGTTTCCACCGATCTTCGCGACAAATTCTGGCCATATAAACCGGATTCATCACAACAATCAAACTGTACGTCGGATTTAATTAGCGAAACAAGATGGGCACGGATCTCTGATTGTAGCGTTTCACAATTATACTCAACAAAAGCCCCGATAAATCTCCCAAAATTGAACTCCCCGACAATTCAAATCGGCAAGAG...

Protein

Download Protein FASTA

410 aa · TkA06G048740|TK1151|PROTEIN

MGSLSGLFQRPVVAASAVALASVSTDLRDKFWPYKPDSSQQSNCTSDLISETRWARISDCSVSQLYSTKAPINLPKLNSPTIQIGKSCASNKITSDVASFSALLNVYKSAELAKSHRPIDYAPSIPPSVSNDVIYQWHLPQANPNAVNPSENSKTVVVLLGWLGAKQKHLKKYADWYTSQGFHVITFTFPMSEIVSYQVGGKTEEHINSLVNHLSDWLEEEYGKNLVFHTFSNTGWLIYGAILEKFQIQDDTLMGRIKGC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G048740`
TK1151 ID	TkA06G048740
OH-1004 ID	LXL04_007180
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.900
Protein coverage (%)	TK1151 61.707 / OH-1004 64.322 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G048740`
Location	Chr06:13215810-13219143 (+)
Description	Similar to tmem53: Transmembrane protein 53
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007180` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0030279 negative regulation of ossification Biological Process GO:0046822 regulation of nucleocytoplasmic transport Biological Process GO:0005634 nucleus Cellular Component GO:0005640 nuclear outer membrane Cellular Component GO:0031965 nuclear membrane Cellular Component
KEGG gene cross-reference	bta:540738 dre:436910 hsa:79639 mmu:68777 xla:446324 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.911

Rank 1 · TkA06G048740 · TK1151

Mitochondrion0.085

Rank 2 · TkA06G048740 · TK1151

Cytoplasm0.052

Rank 3 · TkA06G048740 · TK1151

Nucleus0.045

Rank 4 · TkA06G048740 · TK1151

Peroxisome0.019

Rank 5 · TkA06G048740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01738DLH149-186 aa

PF05705DUF829155-407 aa

PF01738DLH345-370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G048740	`PF01738`	DLH	149	186	0.26	11.6
TkA06G048740	`PF05705`	DUF829	155	407	2.8e-70	237.6
TkA06G048740	`PF01738`	DLH	345	370	0.26	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card