TkA06G047350 | RubberDandelionOmics

Gene overview

TkA06G047350

Reference: TK1151 Chr: Chr06 Coordinates: 12819367-12822847 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2471 bp · TkA06G047350|TK1151|cDNA

CTTGATATGGCCATACCACAATAATCCAATTAGTAAAAACTATATTCTATTTATTTTAATATCAAGCATACAAGTCGTGGTATATTCTATATATACTATATGAATCGAACCATTAGAACTCAAAGATAGACATGGAGCACACTGAGGAGCTCGAAAATGGCGATCGAACGGCAAAAAGCAATCAAAATCTTCTGGAGGAGGAAGCAGAAGTGGCTGATGAATCAAAGGAAAAAGAAATAGAGTCGGTAGAGATGGTATTT...

CDS

Download CDS FASTA

2130 bp · TkA06G047350|TK1151|CDS

ATGGAGCACACTGAGGAGCTCGAAAATGGCGATCGAACGGCAAAAAGCAATCAAAATCTTCTGGAGGAGGAAGCAGAAGTGGCTGATGAATCAAAGGAAAAAGAAATAGAGTCGGTAGAGATGGTATTTAGGGACACGATGGTTCCGTCATGGAAGGGTCAGTTGACAGTGCGGGCGTTTGTTGTGAGCGCGATATTGGGTGTTGTGTTTAGTTTCATAGTAATGAAGTTGAATCTAACGACGGGGATCATACCGTCGCT...

Protein

Download Protein FASTA

709 aa · TkA06G047350|TK1151|PROTEIN

MEHTEELENGDRTAKSNQNLLEEEAEVADESKEKEIESVEMVFRDTMVPSWKGQLTVRAFVVSAILGVVFSFIVMKLNLTTGIIPSLNVAAGLLGFFFVKTWTKALEHCGLLKHPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSDTVAAQSSDANSPLRSMNIKNPSLSWMIGFLFIVSFIGLCSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRALGKFFSFSFLWSFFQWFFVSADDCGFE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G047350`
TK1151 ID	TkA06G047350
OH-1004 ID	LXL04_025651
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 99.859 / OH-1004 48.163 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G047350

Location Chr06:12819367-12822847 (-)

Description Similar to YSL7: Probable metal-nicotianamine transporter YSL7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65730`	May be involved in the transport of nicotianamine-chelated metals.	No verified direct reference in this release
`At3g17650`	May be involved in the transport of nicotianamine-chelated metals.	No verified direct reference in this release
`At1g48370`	May be involved in the transport of nicotianamine-chelated metals.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0524600`	May be involved in the transport of nicotianamine-chelated metals.	No verified direct reference in this release
`Os02g0633300`	May be involved in the transport of nicotianamine-chelated metals.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025651 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0016020 membrane Cellular Component

GO:0035673 oligopeptide transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G65730

dosa:Os04g0524600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.532

Rank 1 · TkA06G047350 · TK1151

Lysosome / Vacuole0.226

Rank 2 · TkA06G047350 · TK1151

Endoplasmic reticulum0.128

Rank 3 · TkA06G047350 · TK1151

Cytoplasm0.074

Rank 4 · TkA06G047350 · TK1151

Golgi apparatus0.056

Rank 5 · TkA06G047350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03169OPT54-678 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G047350	`PF03169`	OPT	54	678	9.3e-167	557.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHY2`	Arabidopsis thaliana	sp\|Q9SHY2\|YSL7_ARATH Probable metal-nicotianamine transporter YSL7	71.600%	Swiss-Prot	High
`Q9LUN2`	Arabidopsis thaliana	sp\|Q9LUN2\|YSL5_ARATH Probable metal-nicotianamine transporter YSL5	70.600%	Swiss-Prot	High
`Q6R3K4`	Arabidopsis thaliana	sp\|Q6R3K4\|YSL8_ARATH Probable metal-nicotianamine transporter YSL8	68.600%	Swiss-Prot	High
`Q5JQD7`	Oryza sativa subsp. japonica	sp\|Q5JQD7\|YSL12_ORYSJ Probable metal-nicotianamine transporter YSL12	70.900%	Swiss-Prot	High
`Q6H7J6`	Oryza sativa subsp. japonica	sp\|Q6H7J6\|YSL14_ORYSJ Probable metal-nicotianamine transporter YSL14	70.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card