TkA06G046370 | RubberDandelionOmics

Gene overview

TkA06G046370

Reference: TK1151 Chr: Chr06 Coordinates: 12573501-12576818 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1554 bp · TkA06G046370|TK1151|cDNA

CTCGTCTCTCGTAAATTCGTAATCAACAACAAACAAAGATTTACTCTCTGTATCTACGGCGCCCTACTGCTCGACATAGTTTCTCCGATCTCGCCTTATCGACTCTCGCCGTTACTCTCCGTTCTTGATGCTAGTTATATAGCTCAAGATTTTTCGTGAGATAGGAGAAAAAATGGCAAATTACTCATCAAAAGGAGCCCCTTCAAATGGATCCGTATATGTTTGTAATTTGCCTCCAGGAACAGATGAAGACATGATAG...

CDS

Download CDS FASTA

1161 bp · TkA06G046370|TK1151|CDS

ATGGCAAATTACTCATCAAAAGGAGCCCCTTCAAATGGATCCGTATATGTTTGTAATTTGCCTCCAGGAACAGATGAAGACATGATAGCCGAATTCTTTGGCACTATTGGCCTGCTAAAGAAAGATAAAAGAACAGGTCGACCAAAGATATGGTTATATCGCGACAAAACAACAAACGAACCTAAAGGAGATGCTACAGTGACATATGAAGATCCATATGCTGCACAAGCTGCTGTAGAATGGTTCAACAATAAAGACTT...

Protein

Download Protein FASTA

386 aa · TkA06G046370|TK1151|PROTEIN

MANYSSKGAPSNGSVYVCNLPPGTDEDMIAEFFGTIGLLKKDKRTGRPKIWLYRDKTTNEPKGDATVTYEDPYAAQAAVEWFNNKDFHGTVIEVLMAESKNSQNVVVPPVIEPSLVVGDVIGVDETGGDTTEGGGRGRGRGGGGDGSNAPPKAWQQDGDWQCPNTSCSNVNFAFRGVCNRCGSARPAGASGGGAGAAGRGRGRGGPDAGGGRGAGGPTGLFGPNDWPCPMCGNINWAKRLKCNICNTNKPGVSEGGVRGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G046370`
TK1151 ID	TkA06G046370
OH-1004 ID	LXL04_025667
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.000
Protein coverage (%)	TK1151 87.047 / OH-1004 87.500 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G046370

Location Chr06:12573501-12576818 (+)

Description Similar to TAF15: Transcription initiation factor TFIID subunit 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50300`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025667 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0006396 RNA processing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048255 mRNA stabilization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005669 transcription factor TFIID complex Cellular Component

KEGG gene cross-reference

ath:AT1G50300

dme:Dmel_CG3606

gga:424717

hsa:8148

ssc:733651

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · TkA06G046370 · TK1151

Cytoplasm0.198

Rank 2 · TkA06G046370 · TK1151

Cell membrane0.027

Rank 3 · TkA06G046370 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA06G046370 · TK1151

Mitochondrion0.012

Rank 5 · TkA06G046370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076RRM_115-92 aa

PF13893RRM_562-100 aa

PF00641Zn_ribbon_RanBP157-186 aa

PF22747Zn_ribbon_DUF2089178-183 aa

PF00641Zn_ribbon_RanBP225-251 aa

PF22747Zn_ribbon_DUF2089228-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G046370	`PF00076`	RRM_1	15	92	8.9e-11	42.2
TkA06G046370	`PF13893`	RRM_5	62	100	0.36	11.3
TkA06G046370	`PF00641`	Zn_ribbon_RanBP	157	186	7.7e-11	41.8
TkA06G046370	`PF22747`	Zn_ribbon_DUF2089	178	183	2.1	9.2
TkA06G046370	`PF00641`	Zn_ribbon_RanBP	225	251	7.7e-11	41.8
TkA06G046370	`PF22747`	Zn_ribbon_DUF2089	228	248	2.1	9.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9AST1`	Arabidopsis thaliana	sp\|Q9AST1\|TAF15_ARATH Transcription initiation factor TFIID subunit 15	67.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card