TkA06G042930 | RubberDandelionOmics

Gene overview

TkA06G042930

Reference: TK1151 Chr: Chr06 Coordinates: 11608134-11610512 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1164 bp · TkA06G042930|TK1151|cDNA

GCCGCCCCCTCATTTCTTTAACGAAACTTAATTGACCAACTTTTAATCCTTTATAATCCCTCTCTTCTTCACACCTCTCTTTTCTCTCGCGCCACCACCACCACCACCCCCACCACACCCATATAAACTCATATCTCTCTCTTTACTCTCTCTAAAATGAACAACAACAGCGGTCCAATATTTTCCTACTCATCGTCGTCACCATCGTCTTCAATTCCTGATATTCATTCATCGTATTTATCATTAAACATGGTGGAAAG...

CDS

Download CDS FASTA

582 bp · TkA06G042930|TK1151|CDS

ATGAACAACAACAGCGGTCCAATATTTTCCTACTCATCGTCGTCACCATCGTCTTCAATTCCTGATATTCATTCATCGTATTTATCATTAAACATGGTGGAAAGCAATCGTGGTGATTACAGTAACTATCAGGATCAGATGGGGTTAATGGAGAAAGATCGAAACAAGTATGAAAGCTCCGACGATGTGGTGGCGGATCATGTTTCTCCGAGCAGCAGCAGCCGAGCTAACGGCGATGGTAAGGAGGTGATCATGGCGGC...

Protein

Download Protein FASTA

193 aa · TkA06G042930|TK1151|PROTEIN

MNNNSGPIFSYSSSSPSSSIPDIHSSYLSLNMVESNRGDYSNYQDQMGLMEKDRNKYESSDDVVADHVSPSSSSRANGDGKEVIMAAGKSSIRKGEKKIRKPKHAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRNYYRCTHQGCNVKKQVQRLSNDDGVVVTTYEGTHSHPIEKSTDNFEHILTQMQIYSR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G042930`
TK1151 ID	TkA06G042930
OH-1004 ID	LXL04_025751
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G042930

Location Chr06:11608134-11610512 (-)

Description Similar to WRKY75: Probable WRKY transcription factor 75

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13080`	Transcription factor.	No verified direct reference in this release
`At3g01970`	Transcription factor.	No verified direct reference in this release
`At1g64000`	Transcription factor.	No verified direct reference in this release
`At5g41570`	Transcription factor.	No verified direct reference in this release
`At2g46130`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025751 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006817 phosphate ion transport Biological Process

GO:0010055 atrichoblast differentiation Biological Process

GO:0032107 regulation of response to nutrient levels Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0048527 lateral root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G64000

ath:AT2G46130

ath:AT3G01970

ath:AT5G13080

ath:AT5G41570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA06G042930 · TK1151

Cytoplasm0.085

Rank 2 · TkA06G042930 · TK1151

Cell membrane0.024

Rank 3 · TkA06G042930 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA06G042930 · TK1151

Plastid0.010

Rank 5 · TkA06G042930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24183DUF741242-105 aa

PF03106WRKY116-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G042930	`PF24183`	DUF7412	42	105	0.039	14.9
TkA06G042930	`PF03106`	WRKY	116	173	1.7e-27	96.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYA2`	Arabidopsis thaliana	sp\|Q9FYA2\|WRK75_ARATH Probable WRKY transcription factor 75	81.400%	Swiss-Prot	Medium
`Q9S763`	Arabidopsis thaliana	sp\|Q9S763\|WRK45_ARATH Probable WRKY transcription factor 45	72.800%	Swiss-Prot	Low
`Q8VWQ4`	Arabidopsis thaliana	sp\|Q8VWQ4\|WRK56_ARATH Probable WRKY transcription factor 56	61.000%	Swiss-Prot	Medium
`Q9FFS3`	Arabidopsis thaliana	sp\|Q9FFS3\|WRK24_ARATH Probable WRKY transcription factor 24	63.300%	Swiss-Prot	Medium
`Q8GY11`	Arabidopsis thaliana	sp\|Q8GY11\|WRK43_ARATH Probable WRKY transcription factor 43	57.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card