TkA06G041320 | RubberDandelionOmics

Gene overview

TkA06G041320

Reference: TK1151 Chr: Chr06 Coordinates: 11175557-11179767 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1609 bp · TkA06G041320|TK1151|cDNA

TTGCTGATTCAGTTATATTGTTTTTTACGTTTGTAATCTATGTTTCAAAATATGTTTTTTTGTTTTCCAGAAATTGGTTTTGTGAAGCACACAATTGAGCTGATGAGAGAAATGATAAGCCTTTTGTTTCTAAAGCAAATATGCCTCTTTTTACTTCTACGATGATTATAATATTAATTTGCAATGATTCTGTAGTTTCAGTATGGTTTTTTTGTTGAAGATGATGGGTATGAACCGAAATCTAAAAGTGGGAAGCTATT...

CDS

Download CDS FASTA

759 bp · TkA06G041320|TK1151|CDS

ATGGCAGTGTTGTATTTGGTGACTACATTAGCTCTTACCTCACAAGCACTTTACTATGGTTACTTTTGTGATCAAAATACATCCAAAAGAAAAGACAATAAGATTGAGTCAGCAAACAAGAAAACAAAAGTCAACCAGGAAGAGTCAACGGTTCCTATCCTACCAAAATCTACTCCAAGTTTGCAGATTCCATCAGCAGATTACAGTTCTCCCCCTGAAAGAATATACTACACTTCTGCTAGATCTTTAACTAGAAGTCA...

Protein

Download Protein FASTA

252 aa · TkA06G041320|TK1151|PROTEIN

MAVLYLVTTLALTSQALYYGYFCDQNTSKRKDNKIESANKKTKVNQEESTVPILPKSTPSLQIPSADYSSPPERIYYTSARSLTRSHTPTNFFHRTTTTPICDQDSVHEPLIGATSPPTSQPKPMLCVVFIVGIFRYASNLKLEENSYLDSIPNEGIVIQVGRKLLQVNEGSGSIGIGTFLGWGMAAIYMGGRFPQIFLNIRRGHVQGLNPLMFVFALLGNSTYVARIFVIIMCNLILKLNWREGGAFSGFF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G041320`
TK1151 ID	TkA06G041320
OH-1004 ID	LXL04_021071
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 91.270 / OH-1004 69.277 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G041320`
Location	Chr06:11175557-11179767 (-)
Description	Similar to YPQ1: Probable vacuolar amino acid transporter YPQ1 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021071` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0034488 basic amino acid transmembrane export from vacuole Biological Process GO:0090517 L-lysine transmembrane import into vacuole Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0016020 membrane Cellular Component GO:0015174 basic amino acid transmembrane transporter activity Molecular Function GO:0015189 L-lysine transmembrane transporter activity Molecular Function
KEGG gene cross-reference	sce:YOL092W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.330

Rank 1 · TkA06G041320 · TK1151

Golgi apparatus0.209

Rank 2 · TkA06G041320 · TK1151

Lysosome / Vacuole0.160

Rank 3 · TkA06G041320 · TK1151

Nucleus0.124

Rank 4 · TkA06G041320 · TK1151

Cytoplasm0.109

Rank 5 · TkA06G041320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04193PQ-loop125-141 aa

PF04193PQ-loop177-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G041320	`PF04193`	PQ-loop	125	141	2.7e-13	50.2
TkA06G041320	`PF04193`	PQ-loop	177	229	2.7e-13	50.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card