TkA06G041070 | RubberDandelionOmics

Gene overview

TkA06G041070

Reference: TK1151 Chr: Chr06 Coordinates: 11105376-11106827 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · TkA06G041070|TK1151|cDNA

ATGACATGGCCAGTTTTCGGTATACTTCCAACGGTACTCTTACACGTGACCCACATTTATGAATGGGGTGGTGAAGCTTTAGTCAAATCCGGTGGAAGCTTTTACTATAGAGGTATGTGGATGGGTGGTACTTACGGTATTGCCACATGCGATCCTGAAAAAATCGAGTACATACTCAAGACAAATTTCAAGAATTACCCGAAGGGTAAAGCTTACAGGGAAAGATTCTATGATTTTCTTGGAGATGGGATTTTTAACGC...

CDS

Download CDS FASTA

1383 bp · TkA06G041070|TK1151|CDS

ATGACATGGCCAGTTTTCGGTATACTTCCAACGGTACTCTTACACGTGACCCACATTTATGAATGGGGTGGTGAAGCTTTAGTCAAATCCGGTGGAAGCTTTTACTATAGAGGTATGTGGATGGGTGGTACTTACGGTATTGCCACATGCGATCCTGAAAAAATCGAGTACATACTCAAGACAAATTTCAAGAATTACCCGAAGGGTAAAGCTTACAGGGAAAGATTCTATGATTTTCTTGGAGATGGGATTTTTAACGC...

Protein

Download Protein FASTA

460 aa · TkA06G041070|TK1151|PROTEIN

MTWPVFGILPTVLLHVTHIYEWGGEALVKSGGSFYYRGMWMGGTYGIATCDPEKIEYILKTNFKNYPKGKAYRERFYDFLGDGIFNADDELWRHQRRVANSEMHSARFTQFSMNAIKTLVHEKLLKLLEAKRGCVIDLQDVLLRFTFDNTCAVAFGVNSGCLDVDLPEIPFAKAFEQVTYASLLRFLMPPYVWKPLKFFRLGFEKTLHESVKIVHDFAEKTVKERKMELVGNKEAINSNSSMEQDREEAFFTDKLLQDFC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G041070`
TK1151 ID	TkA06G041070
OH-1004 ID	LXL04_025798
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.700
Protein coverage (%)	TK1151 96.957 / OH-1004 54.640 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G041070

Location Chr06:11105376-11106827 (-)

Description Similar to PBB2: Proteasome subunit beta type-7-B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23190`	Involved in very long chain fatty acids (VLCFA) omega- hydroxylation.	CYP86B1 is required for very long chain omega-hydroxyacid and alpha, omega -dicarboxylic acid synthesis in root and seed suberin polyester.2009 · DOI: 10.1104/pp.109.141408 Identification of an Arabidopsis feruloyl-coenzyme A transferase required for suberin synthesis.2009 · DOI: 10.1104/pp.109.144907
`At1g63710`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335
`At1g01600`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335 Nanoridges that characterize the surface morphology of flowers require the synthesis of cutin polyester.2009 · DOI: 10.1073/pnas.0909090106
`At4g00360`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Arabidopsis CYP86A2 represses Pseudomonas syringae type III genes and is required for cuticle development.2004 · DOI: 10.1038/sj.emboj.7600290 Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025798 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G01600

ath:AT1G63710

ath:AT3G27430

ath:AT5G23190

ath:AT5G40580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.927

Rank 1 · TkA06G041070 · TK1151

Cytoplasm0.053

Rank 2 · TkA06G041070 · TK1151

Cell membrane0.042

Rank 3 · TkA06G041070 · TK1151

Golgi apparatus0.028

Rank 4 · TkA06G041070 · TK1151

Nucleus0.027

Rank 5 · TkA06G041070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45038-441 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G041070	`PF00067`	p450	38	441	2.7e-68	231.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMY1`	Arabidopsis thaliana	sp\|Q9FMY1\|C86B1_ARATH Cytochrome P450 86B1	50.500%	Swiss-Prot	High
`Q9CAD6`	Arabidopsis thaliana	sp\|Q9CAD6\|C86A7_ARATH Cytochrome P450 86A7	38.700%	Swiss-Prot	Medium
`Q9LMM1`	Arabidopsis thaliana	sp\|Q9LMM1\|C86A4_ARATH Cytochrome P450 86A4	39.500%	Swiss-Prot	Medium
`O23066`	Arabidopsis thaliana	sp\|O23066\|C86A2_ARATH Cytochrome P450 86A2	39.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card