TkA06G040730 | RubberDandelionOmics

Gene overview

TkA06G040730

Reference: TK1151 Chr: Chr06 Coordinates: 11015332-11015859 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

342 bp · TkA06G040730|TK1151|cDNA

ATGCAAGATGGGACGCCATGGCCTGGAAATGATAGTCGTGATCATCCCGGGATGATTCAGGTTTATCTCGGAAGCGGAGGTGCGCTTGATGTTGAAGGCAATGAATTGCCGAAACTGGTTTATGTTTCTCGTGAAAAGCGACCTGGTTATAATCATCACAAAAAGGTCGGAGCTATGAATGCCCTCATTCGAGTTTCCGCCGTGCTTACAAATGCGCCGTTCATGCTGAATCTCGATTGTGATCACTACGTCAACAACAG...

CDS

Download CDS FASTA

342 bp · TkA06G040730|TK1151|CDS

ATGCAAGATGGGACGCCATGGCCTGGAAATGATAGTCGTGATCATCCCGGGATGATTCAGGTTTATCTCGGAAGCGGAGGTGCGCTTGATGTTGAAGGCAATGAATTGCCGAAACTGGTTTATGTTTCTCGTGAAAAGCGACCTGGTTATAATCATCACAAAAAGGTCGGAGCTATGAATGCCCTCATTCGAGTTTCCGCCGTGCTTACAAATGCGCCGTTCATGCTGAATCTCGATTGTGATCACTACGTCAACAACAG...

Protein

Download Protein FASTA

113 aa · TkA06G040730|TK1151|PROTEIN

MQDGTPWPGNDSRDHPGMIQVYLGSGGALDVEGNELPKLVYVSREKRPGYNHHKKVGAMNALIRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDLQLGKKLCYVQFPQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G040730`
TK1151 ID	TkA06G040730
OH-1004 ID	LXL04_036828
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 11.003 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G040730

Location Chr06:11015332-11015859 (+)

Description Similar to CESA4: Cellulose synthase A catalytic subunit 4 [UDP-forming]

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44030`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	Impairment of cellulose synthases required for Arabidopsis secondary cell wall formation enhances disease resistance.2007 · DOI: 10.1105/tpc.106.048058

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0467800`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation (By similarity).	Three distinct rice cellulose synthase catalytic subunit genes required for cellulose synthesis in the secondary wall.2003 · DOI: 10.1104/pp.103.022442
`UniProt: A2XNT2`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release
`Os03g0837100`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release
`Os07g0424400`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036828 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0016759 cellulose synthase activity Molecular Function

GO:0016760 cellulose synthase (UDP-forming) activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G44030

dosa:Os03g0837100

dosa:Os07g0424400

dosa:Os10g0467800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.512

Rank 1 · TkA06G040730 · TK1151

Golgi apparatus0.155

Rank 2 · TkA06G040730 · TK1151

Cytoplasm0.144

Rank 3 · TkA06G040730 · TK1151

Endoplasmic reticulum0.134

Rank 4 · TkA06G040730 · TK1151

Lysosome / Vacuole0.089

Rank 5 · TkA06G040730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552Cellulose_synt1-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G040730	`PF03552`	Cellulose_synt	1	113	2.6e-65	222.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JA6`	Arabidopsis thaliana	sp\|Q84JA6\|CESA4_ARATH Cellulose synthase A catalytic subunit 4 [UDP-forming]	85.800%	Swiss-Prot	High
`Q9AV71`	Oryza sativa subsp. japonica	sp\|Q9AV71\|CESA7_ORYSJ Cellulose synthase A catalytic subunit 7 [UDP-forming]	91.200%	Swiss-Prot	High
`A2XNT2`	Oryza sativa subsp. indica	sp\|A2XNT2\|CESA5_ORYSI Probable cellulose synthase A catalytic subunit 5 [UDP-forming]	83.200%	Swiss-Prot	High
`Q851L8`	Oryza sativa subsp. japonica	sp\|Q851L8\|CESA5_ORYSJ Probable cellulose synthase A catalytic subunit 5 [UDP-forming]	83.200%	Swiss-Prot	High
`Q69V23`	Oryza sativa subsp. japonica	sp\|Q69V23\|CESA3_ORYSJ Probable cellulose synthase A catalytic subunit 3 [UDP-forming]	82.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card