TkA06G039990 | RubberDandelionOmics

Gene overview

TkA06G039990

Reference: TK1151 Chr: Chr06 Coordinates: 10793186-10795626 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1695 bp · TkA06G039990|TK1151|cDNA

CCGATTAAAGAGTACCCCACTTATTTGTTTGTTTACTCGGTACTTGAATTAACCGACTACAAATCGTACAAAACATAACAAATGGTACGGAAATGACATTTTCAGCCCTGCAAATATGCTCGCTTTTCCTAACTTCCTTTGGTACCATCTTATGGCCTCCATTCCTCTGGTCAATACTGTTTCCACTCCTTGGTACAAATACACAGAGTATCAGATTCCTCTAGTAGAAAGCTTTTTATGCTGATATAGATCATACCCAA...

CDS

Download CDS FASTA

1170 bp · TkA06G039990|TK1151|CDS

ATGGTGGCATTAGAGTGGCTAAGACCTGTTGTAGATACATTGGGATGGGACTACTGCATTGTTTGGCTATTTGGTGATGATCCTTCAAGGTACATTGAGTGGAGTTGGTGTTGTTGCAATGGTAGTCGAGGTGTTTGTAGAAATGTCAAAGAGGAAATCGATGCAACGAAACAACATTTTCCTCAATTATGCAGAGATACTTATGTTAATCACTCTTTGAGGACAAAAGCTTGCGAGAAACTAGCTACGATTCCTTTTCA...

Protein

Download Protein FASTA

389 aa · TkA06G039990|TK1151|PROTEIN

MVALEWLRPVVDTLGWDYCIVWLFGDDPSRYIEWSWCCCNGSRGVCRNVKEEIDATKQHFPQLCRDTYVNHSLRTKACEKLATIPFHLPLYSGIHGEVAMSSQPAWIHDTIGTQVLMPVNGGLIELYRSKLVQRDPDMIETLTTQFNIFSAKYIMSPKTEASPNGSNSSFISVDSTQFSPINFLGHDVSSKKKQYMKIKQKNGKELYQSKNLVTERNRRNRIKDGLFALRALVPKISKMDRASIVGDAVEYIKELQLNVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G039990`
TK1151 ID	TkA06G039990
OH-1004 ID	LXL04_025846
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G039990

Location Chr06:10793186-10795626 (-)

Description Similar to BHLH90: Transcription factor bHLH90

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10610`	Transcription factor bHLH90.	No verified direct reference in this release
`At2g16910`	Transcription factor.	No verified direct reference in this release
`At1g12860`	Mediates stomatal differentiation in the epidermis probably by controlling successive roles of SPCH, MUTE, and FAMA.	SCREAM/ICE1 and SCREAM2 specify three cell-state transitional steps leading to arabidopsis stomatal differentiation.2008 · DOI: 10.1105/tpc.108.060848
`At3g26744`	Transcriptional activator that regulates the cold-induced transcription of CBF/DREB1 genes.	SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1A expression and freezing tolerance in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048397 SCREAM/ICE1 and SCREAM2 specify three cell-state transitional steps leading to arabidopsis stomatal differentiation.2008 · DOI: 10.1105/tpc.108.060848

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0120500`	Transcription factor involved in the regulation of tapetum programmed cell death (PCD) and degradation during male reproductive development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025846 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0010444 guard mother cell differentiation Biological Process

GO:0048653 anther development Biological Process

GO:0048654 anther morphogenesis Biological Process

GO:0048657 anther wall tapetum cell differentiation Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0050826 response to freezing Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G10610

ath:AT1G12860

ath:AT2G16910

dosa:Os02g0120500

osa:4328113

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.880

Rank 1 · TkA06G039990 · TK1151

Cytoplasm0.177

Rank 2 · TkA06G039990 · TK1151

Cell membrane0.050

Rank 3 · TkA06G039990 · TK1151

Endoplasmic reticulum0.030

Rank 4 · TkA06G039990 · TK1151

Plastid0.014

Rank 5 · TkA06G039990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14215bHLH-MYC_N7-146 aa

PF00010HLH213-256 aa

PF23177bHLH_IRO3213-275 aa

PF23173bHLH_SAC51215-260 aa

PF22754bHLH-TF_ACT-like_plant249-263 aa

PF08954Trimer_CC250-271 aa

PF22754bHLH-TF_ACT-like_plant312-381 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G039990	`PF14215`	bHLH-MYC_N	7	146	2.5e-14	54.7
TkA06G039990	`PF00010`	HLH	213	256	3.8e-11	43.3
TkA06G039990	`PF23177`	bHLH_IRO3	213	275	7.8e-06	26.9
TkA06G039990	`PF23173`	bHLH_SAC51	215	260	0.0029	18.2
TkA06G039990	`PF22754`	bHLH-TF_ACT-like_plant	249	263	1.3e-08	35.5
TkA06G039990	`PF08954`	Trimer_CC	250	271	0.12	12.7
TkA06G039990	`PF22754`	bHLH-TF_ACT-like_plant	312	381	1.3e-08	35.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WNR2`	Arabidopsis thaliana	sp\|Q0WNR2\|BH090_ARATH Transcription factor bHLH90	34.300%	Swiss-Prot	Medium
`Q9ZVX2`	Arabidopsis thaliana	sp\|Q9ZVX2\|AMS_ARATH Transcription factor ABORTED MICROSPORES	28.800%	Swiss-Prot	Low
`Q9LPW3`	Arabidopsis thaliana	sp\|Q9LPW3\|SCRM2_ARATH Transcription factor SCREAM2	37.400%	Swiss-Prot	Low
`Q9LSE2`	Arabidopsis thaliana	sp\|Q9LSE2\|ICE1_ARATH Transcription factor ICE1	36.300%	Swiss-Prot	Low
`Q6YUS3`	Oryza sativa subsp. japonica	sp\|Q6YUS3\|TDR_ORYSJ Transcription factor TDR	23.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card