TkA06G039410 | RubberDandelionOmics

Gene overview

TkA06G039410

Reference: TK1151 Chr: Chr06 Coordinates: 10612642-10614173 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · TkA06G039410|TK1151|cDNA

AACTTATATAACTTGAATTACATGACTCATGGTAGCATTCACATAAGAAAGAAGAAGATGGAAGGGATAGTGCACAAGACCATAAGTGCAAATGGGCTTAGTATTCACATAGCAGAAAAGGGTGAAGGTCCATTAGTTTTGTTCGTCCATGGCTTCCCTGAGCTCTGGTACTCCTGGCGTCACCAGATTGTGTATTTGGCTGATCATGGTTACCGAGCTGTAGCACCAGATCTTCGTGGCTACGGTGATACAACTGGTGC...

CDS

Download CDS FASTA

768 bp · TkA06G039410|TK1151|CDS

ATGACTCATGGTAGCATTCACATAAGAAAGAAGAAGATGGAAGGGATAGTGCACAAGACCATAAGTGCAAATGGGCTTAGTATTCACATAGCAGAAAAGGGTGAAGGTCCATTAGTTTTGTTCGTCCATGGCTTCCCTGAGCTCTGGTACTCCTGGCGTCACCAGATTGTGTATTTGGCTGATCATGGTTACCGAGCTGTAGCACCAGATCTTCGTGGCTACGGTGATACAACTGGTGCACCGGTTAATGACCCCACCAA...

Protein

Download Protein FASTA

255 aa · TkA06G039410|TK1151|PROTEIN

MTHGSIHIRKKKMEGIVHKTISANGLSIHIAEKGEGPLVLFVHGFPELWYSWRHQIVYLADHGYRAVAPDLRGYGDTTGAPVNDPTKFTIYNLVGDLIGLLDAITSEGEKVFVVGHDWGAFVAWHLCLFRPERVKALVNLSVPFFPWNPMGDVIDLMKVVYGEDHYMVRFQVPGEIEAELAGMDSKTIVKKFLTFREPGPIYFPKGKGFKHSPDGAPVTLPPWLSEEDVEYFASKLDKSGISGTGNLLHYGVVPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G039410`
TK1151 ID	TkA06G039410
OH-1004 ID	LXL04_025992
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.800
Protein coverage (%)	TK1151 92.157 / OH-1004 35.180 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G039410`
Location	Chr06:10612642-10614173 (-)
Description	Similar to ephA: Epoxide hydrolase A (Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025992` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0004301 epoxide hydrolase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.738

Rank 1 · TkA06G039410 · TK1151

Nucleus0.295

Rank 2 · TkA06G039410 · TK1151

Peroxisome0.151

Rank 3 · TkA06G039410 · TK1151

Mitochondrion0.064

Rank 4 · TkA06G039410 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA06G039410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07224Chlorophyllase3-129 aa

PF00561Abhydrolase_137-149 aa

PF12146Hydrolase_438-178 aa

PF07819PGAP138-55 aa

PF12697Abhydrolase_639-162 aa

PF07819PGAP1102-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G039410	`PF07224`	Chlorophyllase	3	129	3.6e-08	33.3
TkA06G039410	`PF00561`	Abhydrolase_1	37	149	7.8e-23	82.1
TkA06G039410	`PF12146`	Hydrolase_4	38	178	1.5e-13	51.3
TkA06G039410	`PF07819`	PGAP1	38	55	0.28	11.6
TkA06G039410	`PF12697`	Abhydrolase_6	39	162	8.8e-18	66.4
TkA06G039410	`PF07819`	PGAP1	102	143	0.28	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card