TkA06G039240 | RubberDandelionOmics

Gene overview

TkA06G039240

Reference: TK1151 Chr: Chr06 Coordinates: 10569015-10570735 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

557 bp · TkA06G039240|TK1151|cDNA

AAAGGAGTAACGGATGGTGTCGGCATTCACCCCGTTTTCTACTGCAACAGAAACAAGATGAGCGAAGAGCGGAAGAGATCCTTGGTCGGGCTTATGGCGCCGGCGAAGTCGACTCCCTCTTTTGATGATCGGAAACCCAATGCGCCGGCGCCGTCGATCTCCTCTACTTCCAGCAGCAGGAAAGTCGTCATCAAGAGTGCCGATAGGAAGGAAGAAATGCAAACCGAAGCTGTCAATATCGCCATTTCCGCATTTGAGGA...

CDS

Download CDS FASTA

477 bp · TkA06G039240|TK1151|CDS

ATGAGCGAAGAGCGGAAGAGATCCTTGGTCGGGCTTATGGCGCCGGCGAAGTCGACTCCCTCTTTTGATGATCGGAAACCCAATGCGCCGGCGCCGTCGATCTCCTCTACTTCCAGCAGCAGGAAAGTCGTCATCAAGAGTGCCGATAGGAAGGAAGAAATGCAAACCGAAGCTGTCAATATCGCCATTTCCGCATTTGAGGATCTTAGTGTCGAAAAAGACGTCGCCGAGCAGATAAAGAAAGAATTCGATAAGAATCA...

Protein

Download Protein FASTA

158 aa · TkA06G039240|TK1151|PROTEIN

MSEERKRSLVGLMAPAKSTPSFDDRKPNAPAPSISSTSSSRKVVIKSADRKEEMQTEAVNIAISAFEDLSVEKDVAEQIKKEFDKNHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKQCCCSNLGESACLQLIGKSKPISNVMLIVICSHFFCKLLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G039240`
TK1151 ID	TkA06G039240
OH-1004 ID	LXL04_025987
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.200
Protein coverage (%)	TK1151 74.684 / OH-1004 93.651 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G039240`
Location	Chr06:10569015-10570735 (-)
Description	Similar to Dynein 8 kDa light chain, flagellar outer arm
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025987` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000132 establishment of mitotic spindle orientation Biological Process GO:0007017 microtubule-based process Biological Process GO:0007283 spermatogenesis Biological Process GO:0007290 spermatid nucleus elongation Biological Process GO:0007291 sperm individualization Biological Process GO:0031507 heterochromatin formation Biological Process GO:0034454 microtubule anchoring at centrosome Biological Process GO:0035721 intraciliary retrograde transport Biological Process GO:0044458 motile cilium assembly Biological Process GO:0051017 actin filament bundle assembly Biological Process GO:0141006 transposable element silencing by piRNA-mediated heterochromatin formation Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	cre:CHLRE_03g181150v5 dme:Dmel_CG5450 dme:Dmel_CG6998 rno:140734 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.517

Rank 1 · TkA06G039240 · TK1151

Nucleus0.367

Rank 2 · TkA06G039240 · TK1151

Cell membrane0.117

Rank 3 · TkA06G039240 · TK1151

Mitochondrion0.107

Rank 4 · TkA06G039240 · TK1151

Endoplasmic reticulum0.095

Rank 5 · TkA06G039240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01221Dynein_light42-121 aa

PF16396DUF500547-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G039240	`PF01221`	Dynein_light	42	121	9.8e-33	113.1
TkA06G039240	`PF16396`	DUF5005	47	124	0.16	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card