TkA06G039160 | RubberDandelionOmics

Gene overview

TkA06G039160

Reference: TK1151 Chr: Chr06 Coordinates: 10547801-10548355 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · TkA06G039160|TK1151|cDNA

ATGCATTTCCCATCTAAAAACCTAACCATGAACAACGACGCTCATTCAACAGGTGGCGGGACTTCCTCAATCTACCGTGGAGTCCGAAAGCGCAAATGGGGGAAATGGGTTTCTGAAATCCGTGACCCATTGACCAAATCCCGCATTTGGCTCGGGAGTTTTGAAACACAAGAAATGGCGGCGGTGGCTTACGATGCTGCGTCGTTTTACTTTCGGGGAGACAATGCGACTCTCAATTTCCCACAAATGGCAACTGCACT...

CDS

Download CDS FASTA

555 bp · TkA06G039160|TK1151|CDS

ATGCATTTCCCATCTAAAAACCTAACCATGAACAACGACGCTCATTCAACAGGTGGCGGGACTTCCTCAATCTACCGTGGAGTCCGAAAGCGCAAATGGGGGAAATGGGTTTCTGAAATCCGTGACCCATTGACCAAATCCCGCATTTGGCTCGGGAGTTTTGAAACACAAGAAATGGCGGCGGTGGCTTACGATGCTGCGTCGTTTTACTTTCGGGGAGACAATGCGACTCTCAATTTCCCACAAATGGCAACTGCACT...

Protein

Download Protein FASTA

184 aa · TkA06G039160|TK1151|PROTEIN

MHFPSKNLTMNNDAHSTGGGTSSIYRGVRKRKWGKWVSEIRDPLTKSRIWLGSFETQEMAAVAYDAASFYFRGDNATLNFPQMATALPSPATPSADDIRLAANEAALLLKPTETGPHTGPGHYVPTNIGLSASQIQAINDSPLDTPENWMEFNDPGIYFSQDNINYGVSGSEWNEVLDDSLWNS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G039160`
TK1151 ID	TkA06G039160
OH-1004 ID	LXL04_025982
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 95.109 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G039160

Location Chr06:10547801-10548355 (+)

Description Similar to ERF021: Ethylene-responsive transcription factor ERF021

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71450`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g33760`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g01250`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g77200`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At2g25820`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025982 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0060862 negative regulation of floral organ abscission Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G33760

ath:AT1G71450

ath:AT2G44940

ath:AT4G32800

ath:AT5G25810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.920

Rank 1 · TkA06G039160 · TK1151

Cytoplasm0.129

Rank 2 · TkA06G039160 · TK1151

Plastid0.028

Rank 3 · TkA06G039160 · TK1151

Cell membrane0.028

Rank 4 · TkA06G039160 · TK1151

Endoplasmic reticulum0.023

Rank 5 · TkA06G039160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP225-73 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G039160	`PF00847`	AP2	25	73	1.3e-11	45.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9I2`	Arabidopsis thaliana	sp\|Q9C9I2\|ERF21_ARATH Ethylene-responsive transcription factor ERF021	47.300%	Swiss-Prot	Medium
`Q9LQ28`	Arabidopsis thaliana	sp\|Q9LQ28\|ERF22_ARATH Ethylene-responsive transcription factor ERF022	53.400%	Swiss-Prot	Medium
`Q1ECI2`	Arabidopsis thaliana	sp\|Q1ECI2\|ERF23_ARATH Ethylene-responsive transcription factor ERF023	56.500%	Swiss-Prot	Medium
`O80654`	Arabidopsis thaliana	sp\|O80654\|ERF37_ARATH Ethylene-responsive transcription factor ERF037	60.700%	Swiss-Prot	Low
`Q52QU1`	Arabidopsis thaliana	sp\|Q52QU1\|ERF42_ARATH Ethylene-responsive transcription factor ERF042	58.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card