TkA06G039100 | RubberDandelionOmics

Gene overview

TkA06G039100

Reference: TK1151 Chr: Chr06 Coordinates: 10529263-10532866 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

601 bp · TkA06G039100|TK1151|cDNA

GGGAAGGGGGAGAGATTCCATTTGCCAAATGTGCGAAAGAAAACGAGAAAAAGAGGATTCTCAGATTGGGTGAAATTATCTTTTTACGAATTACAAACCTCTTCGAATCGATTCCAAATTTAGAAATTACTTACTTGGTAGTAGCAGTGTTTGCGTTCGTGGGGGTTTTTGGTTTTTAGTTTTTACACAGCTGCTCACTGTCAATTCGCCAAATTCATTCCCGATTCAGCAATCCAAGATACAGGAAAAATGCGATTCTG...

CDS

Download CDS FASTA

1446 bp · TkA06G039100|TK1151|CDS

ATGGACGGCGGTGGTGATGTGGCTATGACTCCAGCTGGCTTGGACTGGAAATTCTCTCAGGTTTTTGGTGAACGAGCTGCAGGAGAAGAGGTTCAAGAAGTTGATGTGATTTCAGCAATAGAATTTGATAAAGCTGGCGATCATCTTGCAACTGGAGATCGTGGGGGCCGTGTGGTTTTATTTGAAAGAACTGATCAAACAAATTATGGTGTTCATAGAAGAGTTCTAGAAGGAATGGATTGTTCAAGTAGTCGTCACCC...

Protein

Download Protein FASTA

481 aa · TkA06G039100|TK1151|PROTEIN

MDGGGDVAMTPAGLDWKFSQVFGERAAGEEVQEVDVISAIEFDKAGDHLATGDRGGRVVLFERTDQTNYGVHRRVLEGMDCSSSRHPEYRYKTEFQSHEPEFDYLKSLEIEEKINKIKWCQTANSSLFLLSTNDKTIKFWKVQEKKIKKICNFNLDPSKQLRNGFICSSNAPTSLRLPMVTSHDTSLLARCRRTFAHAHDYHINSISNNSDGETFISADDLRINLWNLEINSQSFNIVDMKPANMEDLTEVITSADFHPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G039100`
TK1151 ID	TkA06G039100
OH-1004 ID	LXL04_025981
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G039100

Location Chr06:10529263-10532866 (+)

Description Similar to PP2AB2: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17720`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`At1g51690`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X2K3`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`Os02g0224200`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`Os06g0563300`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025981 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0000159 protein phosphatase type 2A complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0019888 protein phosphatase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G17720

ath:AT1G51690

dosa:Os02g0224200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.753

Rank 1 · TkA06G039100 · TK1151

Cytoplasm0.263

Rank 2 · TkA06G039100 · TK1151

Cell membrane0.053

Rank 3 · TkA06G039100 · TK1151

Lysosome / Vacuole0.044

Rank 4 · TkA06G039100 · TK1151

Golgi apparatus0.034

Rank 5 · TkA06G039100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23726Beta-prop_RSE1_2nd16-169 aa

PF24782WD40_MABP1-WDR62_2nd27-64 aa

PF23098Beta-prop_NOL10_N29-62 aa

PF23409Beta-prop_EML29-134 aa

PF23775Beta-prop_RIG_2nd32-69 aa

PF12894ANAPC4_WD4032-63 aa

PF24807WD40_CDC20-Fz33-67 aa

PF24814WD40_Prp1934-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G039100	`PF23726`	Beta-prop_RSE1_2nd	16	169	0.0028	17.7
TkA06G039100	`PF24782`	WD40_MABP1-WDR62_2nd	27	64	6.8e-05	22.7
TkA06G039100	`PF23098`	Beta-prop_NOL10_N	29	62	3.4e-06	27.2
TkA06G039100	`PF23409`	Beta-prop_EML	29	134	0.00021	21.6
TkA06G039100	`PF23775`	Beta-prop_RIG_2nd	32	69	1.1e-06	29.1
TkA06G039100	`PF12894`	ANAPC4_WD40	32	63	7e-05	23.7
TkA06G039100	`PF24807`	WD40_CDC20-Fz	33	67	4.7e-08	33.4
TkA06G039100	`PF24814`	WD40_Prp19	34	65	2.8e-12	47.0
TkA06G039100	`PF24817`	WD40_WDHD1_1st	34	67	3.6e-08	33.7
TkA06G039100	`PF23414`	Beta-prop_EML_2	34	63	4.9e-06	26.8
TkA06G039100	`PF25175`	Beta-prop_WDR5	36	62	5.7e-15	56.1
TkA06G039100	`PF23381`	Beta-prop_IFT122_1st	36	71	1.2e-11	45.2
TkA06G039100	`PF23393`	Beta-prop_WDR90_POC16_2nd	36	72	8.2e-05	22.7
TkA06G039100	`PF23383`	Beta-prop_IFT140_1st	36	65	0.00011	21.7
TkA06G039100	`PF25171`	Beta-prop_WDR36-Utp21_1st	36	67	0.02	15.0
TkA06G039100	`PF00400`	WD40	37	61	3e-17	63.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39247`	Arabidopsis thaliana	sp\|Q39247\|2ABB_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	72.400%	Swiss-Prot	High
`Q38821`	Arabidopsis thaliana	sp\|Q38821\|2ABA_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	69.200%	Swiss-Prot	High
`A2X2K3`	Oryza sativa subsp. indica	sp\|A2X2K3\|2ABB_ORYSI Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	72.300%	Swiss-Prot	High
`Q0E2P1`	Oryza sativa subsp. japonica	sp\|Q0E2P1\|2ABB_ORYSJ Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	72.300%	Swiss-Prot	High
`Q5Z8Z7`	Oryza sativa subsp. japonica	sp\|Q5Z8Z7\|2ABA_ORYSJ Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	70.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card