TkA06G037910 | RubberDandelionOmics

Gene overview

TkA06G037910

Reference: TK1151 Chr: Chr06 Coordinates: 10156485-10158404 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1661 bp · TkA06G037910|TK1151|cDNA

CAGTCATTTCCGAGGAGTCTTTGGCTTGACGAGAACCAGAAGCAGCTCCGACAATGGCCTATAGAGGAAATCCAAATGTTACGAAAAAAGAAAGTTAGTTTTCGAAATATGAATCTTGAAGGCCGTTCGTCACATGAAATTAAGGGTATAACTGCTGCTCAGGCGGACGTGGATATTTCATTCAAACTGCCGAGTTTAGAAGAAGCCGAAGAACTAGACCCGAGTTTGGTCGATCCGCTAGATATTTGCACATCAAAGAA...

CDS

Download CDS FASTA

645 bp · TkA06G037910|TK1151|CDS

ATGTTACGAAAAAAGAAAGTTAGTTTTCGAAATATGAATCTTGAAGGCCGTTCGTCACATGAAATTAAGGGTATAACTGCTGCTCAGGCGGACGTGGATATTTCATTCAAACTGCCGAGTTTAGAAGAAGCCGAAGAACTAGACCCGAGTTTGGTCGATCCGCTAGATATTTGCACATCAAAGAATGGAAAATTCGGACCGTTTGGGATTTTAGCTTTGGCTTCCAAAGACTTGACTGAACAGACTGCAATCTTTTTTAG...

Protein

Download Protein FASTA

214 aa · TkA06G037910|TK1151|PROTEIN

MLRKKKVSFRNMNLEGRSSHEIKGITAAQADVDISFKLPSLEEAEELDPSLVDPLDICTSKNGKFGPFGILALASKDLTEQTAIFFRVFRKNGRLVVVMCSDQSRTPEAPDFLKPTYAAFVDIDPQQKEISLRTLIDHSIVETFGGGGKTCMTARVYPTLAIGDEARLFAFNHGTESVVISEMSAWSLKNARMNTLSEEDKFINCLGRKLICCN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G037910`
TK1151 ID	TkA06G037910
OH-1004 ID	LXL04_025958
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 38.475 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G037910

Location Chr06:10156485-10158404 (-)

Description Similar to CWINV3: Beta-fructofuranosidase, insoluble isoenzyme CWINV3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55120`	6-fructan exohydrolase that can use phlein, levan, neokestose, levanbiose, 6-kestose, and 1-kestose as substrates.	No verified direct reference in this release
`At3g13790`	Beta-fructofuranosidase that can use sucrose and 1-kestose, and, to a lower extent, neokestose and levan, as substrates, but not inuline.	Unraveling the difference between invertases and fructan exohydrolases: a single amino acid (Asp-239) substitution transforms Arabidopsis cell wall invertase1 into a fructan 1-exohydrolase.2007 · DOI: 10.1104/pp.107.105049
`At5g11920`	6 and 1-fructan exohydrolase that can degrade both inulin and levan-type fructans, such as phlein, levan, neokestose, levanbiose, 6-kestose, 1-kestose, inulin, and 1,1-nystose.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0664900`	May play a role in stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025958 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004564 beta-fructofuranosidase activity Molecular Function

GO:0033949 fructan beta-(2,6)-fructosidase activity Molecular Function

KEGG gene cross-reference

ag:CAD48404

ath:AT1G55120

ath:AT3G13790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.896

Rank 1 · TkA06G037910 · TK1151

Cytoplasm0.032

Rank 2 · TkA06G037910 · TK1151

Lysosome / Vacuole0.022

Rank 3 · TkA06G037910 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA06G037910 · TK1151

Cell membrane0.015

Rank 5 · TkA06G037910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08244Glyco_hydro_32C2-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G037910	`PF08244`	Glyco_hydro_32C	2	187	1.8e-25	90.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67XZ3`	Arabidopsis thaliana	sp\|Q67XZ3\|INV3_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV3	50.700%	Swiss-Prot	High
`Q43866`	Arabidopsis thaliana	sp\|Q43866\|INV1_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV1	49.300%	Swiss-Prot	Medium
`Q8W4S6`	Arabidopsis thaliana	sp\|Q8W4S6\|INV6_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV6	49.700%	Swiss-Prot	Medium
`Q56UD1`	Oryza sativa subsp. japonica	sp\|Q56UD1\|INV5_ORYSJ Beta-fructofuranosidase, insoluble isoenzyme 5	44.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card