RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G037390
Reference: TK1151 Chr: Chr06 Coordinates: 10023838-10027047 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2572 bp · TkA06G037390|TK1151|cDNA

AAAACAATGGTTTGGCAGTCTAAATGATGCTCCAATGGACCAAAAGACATTGGAATATTATGCTAGAAAAATCTCTGTGGAATTTTCTTCCACTCAGTCGTCATAGACGTATTTTCTTCCTCCTCTACAGTTTCATAGAAATGAAGCAACAATGACATTAGGGCTCAATCATTAACTTAGACGACCTAATATTGTCTGAATTTTCGAGGATGCTTCCTAGGCTCGATGATTCACGAATCGAAGTCATTTATACATGCTAC...

CDS

Download CDS FASTA

1977 bp · TkA06G037390|TK1151|CDS

ATGCTTCCTAGGCTCGATGATTCACGAATCGAAGTCATTTATACATGCTACACCCCATCATTGGGGGGAAAGAAAAATCAAAATAAAACACTCATGGCGTCTCCAAATTGGGTGTTAGTTACAGTCAAAATTTCCATTATTACACATCTTGCTTGTCTCACCACTACCAATGGAGATTTCGTCTGCGAACCCCATGGAACTTACAAGCAAAACAGTGCATATAAAAAGAACCTCAATGCCACGTTATCGGAACTTCCAGG...

Protein

Download Protein FASTA

658 aa · TkA06G037390|TK1151|PROTEIN

MLPRLDDSRIEVIYTCYTPSLGGKKNQNKTLMASPNWVLVTVKISIITHLACLTTTNGDFVCEPHGTYKQNSAYKKNLNATLSELPGTHNGAGFFNSSSNSAQDKAYAIALCRARSDFDPYNCLACVKSATNRLQQDCPNQKKATGWYDGNCLLTYSNSTLDVNDNDVVSLMESSISDWGSVVDPLRKLLEQLLGKAARDSNNKASNYSDGTVLPQSTGSIQATMQCIPDIPPDTCGDCLVKATDDLLNCCNGSSEAVVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G037390
TK1151 IDTkA06G037390
OH-1004 IDLXL04_034635
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)61.500
Protein coverage (%)TK1151 94.681 / OH-1004 98.179
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G037390
LocationChr06:10023838-10027047 (-)
DescriptionSimilar to CRK14: Cysteine-rich receptor-like protein kinase 14
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g05200 Cysteine-rich receptor-like protein kinase 25. No verified direct reference in this release
At4g23160 Cysteine-rich receptor-like protein kinase 8. No verified direct reference in this release
At4g11530 Cysteine-rich receptor-like protein kinase 34. No verified direct reference in this release
At4g23250 Cysteine-rich receptor-like protein kinase 17. No verified direct reference in this release
At4g23270 Cysteine-rich receptor-like protein kinase 19. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_034635 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006955 immune response Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0007165 signal transduction Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference
ath:AT4G05200
ath:AT4G21230
ath:AT4G23180
ath:AT4G23200
ath:AT4G23220
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.857
Rank 1 · TkA06G037390 · TK1151
Endoplasmic reticulum0.079
Rank 2 · TkA06G037390 · TK1151
Cytoplasm0.078
Rank 3 · TkA06G037390 · TK1151
Nucleus0.051
Rank 4 · TkA06G037390 · TK1151
Extracellular0.026
Rank 5 · TkA06G037390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657Stress-antifung62-158 aa
PF09321DUF1978153-192 aa
PF01657Stress-antifung186-269 aa
PF00069Pkinase344-611 aa
PF07714PK_Tyr_Ser-Thr347-613 aa
PF03109ABC1349-379 aa
PF26662PH_42359-401 aa
PF03109ABC1410-491 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G037390PF01657Stress-antifung621581.3e-30106.7
TkA06G037390PF09321DUF19781531920.1412.2
TkA06G037390PF01657Stress-antifung1862691.3e-30106.7
TkA06G037390PF00069Pkinase3446116.3e-48164.2
TkA06G037390PF07714PK_Tyr_Ser-Thr3476131e-53183.0
TkA06G037390PF03109ABC13493790.001618.3
TkA06G037390PF26662PH_423594010.2712.3
TkA06G037390PF03109ABC14104910.001618.3
TkA06G037390PF06293Kdo4134800.211.8
TkA06G037390PF17667Pkinase_fungal4515310.05213.0
TkA06G037390PF01636APH4544910.1612.4
TkA06G037390PF01636APH5465800.1612.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M0X5Arabidopsis thalianasp|Q9M0X5|CRK25_ARATH Cysteine-rich receptor-like protein kinase 2541.300%Swiss-ProtMedium
O65468Arabidopsis thalianasp|O65468|CRK8_ARATH Cysteine-rich receptor-like protein kinase 840.000%Swiss-ProtMedium
Q9LDQ3Arabidopsis thalianasp|Q9LDQ3|CRK34_ARATH Cysteine-rich receptor-like protein kinase 3440.300%Swiss-ProtMedium
Q8L710Arabidopsis thalianasp|Q8L710|CRK17_ARATH Cysteine-rich receptor-like protein kinase 1740.600%Swiss-ProtMedium
Q8GWJ7Arabidopsis thalianasp|Q8GWJ7|CRK19_ARATH Cysteine-rich receptor-like protein kinase 1940.000%Swiss-ProtMedium

JBrowse

View in Genome Browser