TkA06G036170 | RubberDandelionOmics

Gene overview

TkA06G036170

Reference: TK1151 Chr: Chr06 Coordinates: 9713176-9713811 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

444 bp · TkA06G036170|TK1151|cDNA

ATGTACGAGGTTCCTTATTTAATTGTCGCATCAAAAGACGATCTTGACCCTTACCCAACTGCAATACAAGACTCCACAAGGGTTAGTCAGGATATGGAAATAGAGGCTCCTATACCCATAAGCATAAAGTTGGGGGACTTGAATATCATATTTGGGAGAAGTTTGAGAGCTGCAGAGCATCCGCATTTGAGCATTCCGGAAACTGAAGCCGGGAAAACTTGGAAGCTTCTTAACCTCTCTCTAATGATTGTCTCAGTGGG...

CDS

Download CDS FASTA

444 bp · TkA06G036170|TK1151|CDS

ATGTACGAGGTTCCTTATTTAATTGTCGCATCAAAAGACGATCTTGACCCTTACCCAACTGCAATACAAGACTCCACAAGGGTTAGTCAGGATATGGAAATAGAGGCTCCTATACCCATAAGCATAAAGTTGGGGGACTTGAATATCATATTTGGGAGAAGTTTGAGAGCTGCAGAGCATCCGCATTTGAGCATTCCGGAAACTGAAGCCGGGAAAACTTGGAAGCTTCTTAACCTCTCTCTAATGATTGTCTCAGTGGG...

Protein

Download Protein FASTA

147 aa · TkA06G036170|TK1151|PROTEIN

MYEVPYLIVASKDDLDPYPTAIQDSTRVSQDMEIEAPIPISIKLGDLNIIFGRSLRAAEHPHLSIPETEAGKTWKLLNLSLMIVSVGAAVAVVLLILSFYFRFCKSTLGCYQGGLRNIISHKSLILIPLFVMSHRRKMKKENLFNRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G036170`
TK1151 ID	TkA06G036170
OH-1004 ID	LXL04_036018
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.700
Protein coverage (%)	TK1151 93.878 / OH-1004 95.172 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G036170

Location Chr06:9713176-9713811 (-)

Description Similar to MIRO1: Mitochondrial Rho GTPase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27540`	Mitochondrial GTPase required to maintain proper development, morphology and intracellular distribution of mitochondria, which in turn are essential for the progress of embryonic cell division, development of haploid male and female gametes, and pollen tube growth.	EMB2473/MIRO1, an Arabidopsis Miro GTPase, is required for embryogenesis and influences mitochondrial morphology in pollen.2008 · DOI: 10.1105/tpc.107.055756 MIRO1 influences the morphology and intracellular distribution of mitochondria during embryonic cell division in Arabidopsis.2011 · DOI: 10.1007/s00299-010-0926-5 Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
`At3g05310`	Mitochondrial GTPase that may be involved in mitochondrion development.	No verified direct reference in this release
`At3g63150`	Calcium-binding mitochondrial GTPase involved in calcium signaling during salt stress response.	Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036018 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007005 mitochondrion organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT3G05310

ath:AT3G63150

ath:AT5G27540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.354

Rank 1 · TkA06G036170 · TK1151

Endoplasmic reticulum0.230

Rank 2 · TkA06G036170 · TK1151

Cytoplasm0.162

Rank 3 · TkA06G036170 · TK1151

Nucleus0.133

Rank 4 · TkA06G036170 · TK1151

Golgi apparatus0.085

Rank 5 · TkA06G036170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21314TM_ErbB186-101 aa

PF21314TM_ErbB1129-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G036170	`PF21314`	TM_ErbB1	86	101	5.2	7.6
TkA06G036170	`PF21314`	TM_ErbB1	129	140	5.2	7.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXF8`	Arabidopsis thaliana	sp\|Q8RXF8\|MIRO1_ARATH Mitochondrial Rho GTPase 1	62.500%	Swiss-Prot	Medium
`Q9MA88`	Arabidopsis thaliana	sp\|Q9MA88\|MIRO3_ARATH Mitochondrial Rho GTPase 3	59.100%	Swiss-Prot	Medium
`F4J0W4`	Arabidopsis thaliana	sp\|F4J0W4\|MIRO2_ARATH Mitochondrial Rho GTPase 2	50.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card