TkA06G035910 | RubberDandelionOmics

Gene overview

TkA06G035910

Reference: TK1151 Chr: Chr06 Coordinates: 9648023-9649868 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · TkA06G035910|TK1151|cDNA

AAGCGCTTCTTCAATGTAATTGCATTCTCGATGCGACATCGCCAGCAGCAGCAGAACAGCGATTGTGTATTTTGCAAAGAGAGAAGCAGCTAAAAAGCTGACGTGGTGAGTTTTCTTCACCACATTTACACTACCAACGAAAATGGCAACTCAAATCAGTAAGAAGCGAAAGTTTGTCGCTGATGTGTCTTCTTCGCTGAGCTGAACGAAGTTCTTACTAGAGAACTCGCAGAAGATGGTTACTCTGGTGTTGAAGTTAG...

CDS

Download CDS FASTA

600 bp · TkA06G035910|TK1151|CDS

ATGGGTACATTCTTACCAAACCTCATTTTTTCAGGTGAGAAAGGAAGAAGAATTAGAGAGTTGACGTCTCTGGTTCAGAAACGTTTCAAGTTCCCAGAAAACAGTGTTGAACTCTATGCTGAAAGAGTCAACAACAGAGGACTTTGCGCCATTGCCCAAGCTGAATCCTTGCGTTACAAGCTTCTTGGAGGTCTTGCTGTCCGCAGGGCTTGCTATGGTGTTCTGAGATTCGTTATGGAGAATGGAGCAAAGGGATGTGA...

Protein

Download Protein FASTA

199 aa · TkA06G035910|TK1151|PROTEIN

MGTFLPNLIFSGEKGRRIRELTSLVQKRFKFPENSVELYAERVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMENGAKGCEVIVSGKLRAQRAKSMKFKDGYMVSSGQPVKEYIDSAVRHVLLRQGVLGIKVKIMLDWDPTGKLGPKTPLPDNVIIHMPKDDVIALPPKEVEEYRPPLVIADEPIPMSVPVSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G035910`
TK1151 ID	TkA06G035910
OH-1004 ID	LXL04_025917
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.472 / OH-1004 76.113 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G035910

Location Chr06:9648023-9649868 (+)

Description Similar to RPS3A: 40S ribosomal protein S3-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31610`	Small ribosomal subunit protein uS3z.	No verified direct reference in this release
`At3g53870`	Small ribosomal subunit protein uS3y.	No verified direct reference in this release
`At5g35530`	Small ribosomal subunit protein uS3x.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025917 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006412 translation Biological Process

GO:0006417 regulation of translation Biological Process

GO:0051301 cell division Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005819 spindle Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G31610

ath:AT3G53870

ath:AT5G35530

ssc:733671

xla:444841

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.850

Rank 1 · TkA06G035910 · TK1151

Nucleus0.276

Rank 2 · TkA06G035910 · TK1151

Endoplasmic reticulum0.083

Rank 3 · TkA06G035910 · TK1151

Mitochondrion0.043

Rank 4 · TkA06G035910 · TK1151

Cell membrane0.031

Rank 5 · TkA06G035910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22823MrpR_C_cat5-47 aa

PF25236DUF78515-59 aa

PF15862Coilin_N11-41 aa

PF07650KH_212-46 aa

PF11543UN_NPL417-48 aa

PF00189Ribosomal_S3_C58-140 aa

PF20606DUF679985-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G035910	`PF22823`	MrpR_C_cat	5	47	0.095	12.8
TkA06G035910	`PF25236`	DUF7851	5	59	0.14	13.0
TkA06G035910	`PF15862`	Coilin_N	11	41	0.092	13.4
TkA06G035910	`PF07650`	KH_2	12	46	0.0025	18.3
TkA06G035910	`PF11543`	UN_NPL4	17	48	0.04	15.2
TkA06G035910	`PF00189`	Ribosomal_S3_C	58	140	9.8e-27	94.0
TkA06G035910	`PF20606`	DUF6799	85	111	0.28	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIP7`	Arabidopsis thaliana	sp\|Q9SIP7\|RS3A_ARATH Small ribosomal subunit protein uS3z	93.100%	Swiss-Prot	High
`Q9M339`	Arabidopsis thaliana	sp\|Q9M339\|RS3B_ARATH Small ribosomal subunit protein uS3y	82.800%	Swiss-Prot	High
`Q9FJA6`	Arabidopsis thaliana	sp\|Q9FJA6\|RS33_ARATH Small ribosomal subunit protein uS3x	86.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card