TkA06G035770 | RubberDandelionOmics

Gene overview

TkA06G035770

Reference: TK1151 Chr: Chr06 Coordinates: 9573545-9576503 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2307 bp · TkA06G035770|TK1151|cDNA

GTCATATCCCCAAACACTACAATCAGTTACCAAAAGCTAAAATTGCGGTAAATCACATATGTTCAAAAACACCTCATAATCATCAAAGCATTTAATTTTAGGAAGATACAAAAAATGGGTAGTTAAAAAGCGTTGGTGGAAGGTGTGTGAAAAGGGTAATGGCACGTACTTGATTTCTTGACGAAGGGGATTACTACCCATTTTTCTTCGTCTAGATGTCGTTTTGTCAAATATAGAAAAACCCCATATTGATTTTACCC...

CDS

Download CDS FASTA

1368 bp · TkA06G035770|TK1151|CDS

ATGAGTAGTAGGTATAGAAAGTCAATTCGTCAGTGCCGCCGGGATGGCGGCGTTGAGGTAGGTGGTAGTGCCGCCTCCGATGAGGGTTTGCCGGAAATTGCAGTAGCCACGAAGCTTAGGTCAAAGCCCCATCAGTTCTATAGCCGAATATTGCCTGGAAAGTCAGAAGGAATGCCGATTTCCCCGGTCAAAATGTTGGCAGGTCGCGAAGGTAATTACTCCGGGAGAGGTAGATTCACATCTGCAGATCGTTGTCACCT...

Protein

Download Protein FASTA

455 aa · TkA06G035770|TK1151|PROTEIN

MSSRYRKSIRQCRRDGGVEVGGSAASDEGLPEIAVATKLRSKPHQFYSRILPGKSEGMPISPVKMLAGREGNYSGRGRFTSADRCHLSSRYLPVNGPSVIDQMSSCAYVSQFSADGTLFVAGFQDSDIKIYSVDNDWKVKKNIRARSLRWTITDTSLSPDQRFLVYSSMSPVVHIVNIGSSMTESVANVTEIHEGLDFSGHDGEEEDDYSFGIFSVKFSTDGRELVAATSDDSIYVYDLVANKLNVRIPAHKSDVNAVCF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G035770`
TK1151 ID	TkA06G035770
OH-1004 ID	LXL04_025911
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G035770`
Location	Chr06:9573545-9576503 (-)
Description	Similar to LEC14B homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025911` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0003016 respiratory system process Biological Process GO:0006979 response to oxidative stress Biological Process GO:0007005 mitochondrion organization Biological Process GO:0010467 gene expression Biological Process GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0050821 protein stabilization Biological Process GO:0005654 nucleoplasm Cellular Component GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component
KEGG gene cross-reference	bta:539433 mmu:28199 rno:305895 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.587

Rank 1 · TkA06G035770 · TK1151

Cytoplasm0.401

Rank 2 · TkA06G035770 · TK1151

Lysosome / Vacuole0.052

Rank 3 · TkA06G035770 · TK1151

Cell membrane0.048

Rank 4 · TkA06G035770 · TK1151

Mitochondrion0.034

Rank 5 · TkA06G035770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24106Beta-prop_EDC4L99-136 aa

PF24805EIF3I103-178 aa

PF29037DSE1_N104-180 aa

PF23381Beta-prop_IFT122_1st105-175 aa

PF24796WDR55105-143 aa

PF00400WD40106-132 aa

PF13570Beta-prop_ACSF4106-129 aa

PF25174Beta-prop_THOC3107-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G035770	`PF24106`	Beta-prop_EDC4L	99	136	0.093	12.5
TkA06G035770	`PF24805`	EIF3I	103	178	1e-14	55.2
TkA06G035770	`PF29037`	DSE1_N	104	180	1.2e-08	35.2
TkA06G035770	`PF23381`	Beta-prop_IFT122_1st	105	175	1.2e-27	97.7
TkA06G035770	`PF24796`	WDR55	105	143	1e-20	74.7
TkA06G035770	`PF00400`	WD40	106	132	4e-30	103.7
TkA06G035770	`PF13570`	Beta-prop_ACSF4	106	129	0.00047	20.4
TkA06G035770	`PF25174`	Beta-prop_THOC3	107	182	3.4e-30	105.7
TkA06G035770	`PF23414`	Beta-prop_EML_2	108	181	1.3e-23	84.4
TkA06G035770	`PF25391`	WD40_Gbeta	108	175	2e-13	50.8
TkA06G035770	`PF23749`	DUF7165	108	147	0.06	12.8
TkA06G035770	`PF25168`	Beta-prop_WDR36-Utp21_2nd	109	201	1.6e-13	51.4
TkA06G035770	`PF16755`	Beta-prop_NUP159_NUP214	109	145	0.022	14.8
TkA06G035770	`PF25173`	Beta-prop_WDR3_1st	110	178	1.8e-39	136.1
TkA06G035770	`PF24807`	WD40_CDC20-Fz	110	186	6.5e-24	85.5
TkA06G035770	`PF24817`	WD40_WDHD1_1st	110	189	3.2e-23	83.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card