Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1668 bp · TkA06G033890|TK1151|cDNA
TTTCACTAGCGGAACAGAGAAGAAGTCATGGATTGGTTATAAAATCTTTATCAGAATAACAATCATACACTTACCAGTTATCAGCATTATAATTCAAGTAATTGATTTAACTTTTACATCACGAAATGCAGATTATCATTTGAAATGAGATTTTGATTTGTGGAGCCAAAAGCGATGGTATGGTGGTTATCTAGCTAAAAATCTAAAAGAAGCATCATTAACGATGGATATGGATCTTAAATTCTGACTGGAAATATAAG...
1137 bp · TkA06G033890|TK1151|CDS
ATGGAGGCTGATCATAATATTGTTAAACAATTGGTAGAAGAAGATAGATTGAGCAGTTTACCAGATGAGCTTCTTCATAAGATCCTAACTTCTTTTGACATGAAATTTGTTGTCCAAACATGTCTTTTGTCATCAAGATGGAAGCTTCTTTGGACATCAATGCCTTGCCTCAGCTTCTCAATTCGCGATTTTTGTACCTCACGAAAGTTTAACAAATTCTTGAAACATGTTCTATCTGATCGCAACCATCAAGTACAAGT...
Protein
Download Protein FASTA378 aa · TkA06G033890|TK1151|PROTEIN
MEADHNIVKQLVEEDRLSSLPDELLHKILTSFDMKFVVQTCLLSSRWKLLWTSMPCLSFSIRDFCTSRKFNKFLKHVLSDRNHQVQVSSVELSFERPLSDVLMRKVADYAFSHNVQELDIYVITTGGWIKFEDYPLCLLGSKSLKHFNFNSNLTLKTPLDFPVLTTLHLNHMILCGELFSKCVNLKNLSLANFSVNVNGVEVFDIITPRLSYLTLINGEGFIRCLCINLIAPQLEHLTIKNCSIKSLNVPPSLSCFWYMG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G033890 |
|---|---|
| TK1151 ID | TkA06G033890 |
| OH-1004 ID | LXL04_025892 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 55.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 15.320Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G033890 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:9175634-9178758 (-) | |||||||||
| Description | Similar to PDH-E1 ALPHA: Pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0045254 pyruvate dehydrogenase complex Cellular Component GO:0004739 pyruvate dehydrogenase (acetyl-transferring) activity Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G01090 dosa:Os04g0119400 rco:RC0347 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00646F-box17-56 aaPF12937F-box-like17-49 aaPF29466F-box_COS11118-93 aaPF00646F-box65-77 aaPF12799LRR_4139-152 aaPF12799LRR_4142-171 aaPF12799LRR_4164-192 aaPF12799LRR_4232-250 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G033890 | PF00646 | F-box | 17 | 56 | 3.4e-06 | 27.4 |
| TkA06G033890 | PF12937 | F-box-like | 17 | 49 | 0.017 | 15.6 |
| TkA06G033890 | PF29466 | F-box_COS111 | 18 | 93 | 0.21 | 12.9 |
| TkA06G033890 | PF00646 | F-box | 65 | 77 | 3.4e-06 | 27.4 |
| TkA06G033890 | PF12799 | LRR_4 | 139 | 152 | 1.1 | 10.4 |
| TkA06G033890 | PF12799 | LRR_4 | 142 | 171 | 1.1 | 10.4 |
| TkA06G033890 | PF12799 | LRR_4 | 164 | 192 | 1.1 | 10.4 |
| TkA06G033890 | PF12799 | LRR_4 | 232 | 250 | 1.1 | 10.4 |
| TkA06G033890 | PF29466 | F-box_COS111 | 269 | 288 | 0.21 | 12.9 |
| TkA06G033890 | PF12799 | LRR_4 | 282 | 288 | 1.1 | 10.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.