TkA06G033530 | RubberDandelionOmics

Gene overview

TkA06G033530

Reference: TK1151 Chr: Chr06 Coordinates: 9069059-9071559 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

630 bp · TkA06G033530|TK1151|cDNA

ATGTCGGATGGAGATGTCACCCAATTCACGTTCGAATCAGTTCACCAGCTTCAGTTATGCAACTCCCTCCAAGTCCTCGGTAGATATCAGGAAATATTCGCTTTGCCATTCGTTTCTGGATCCGATTACGCCGGCGTCGTCGAGTCCGTCGGTCCCACAGTCAACAAATTCAAAATCAGCGACCCTGTATGTTCAGTTGTCGGTGTAGGCTTGGAGTTCCCGATGGATGTCATCTGGTCGTTTACAATGAAGTTACGATA...

CDS

Download CDS FASTA

630 bp · TkA06G033530|TK1151|CDS

ATGTCGGATGGAGATGTCACCCAATTCACGTTCGAATCAGTTCACCAGCTTCAGTTATGCAACTCCCTCCAAGTCCTCGGTAGATATCAGGAAATATTCGCTTTGCCATTCGTTTCTGGATCCGATTACGCCGGCGTCGTCGAGTCCGTCGGTCCCACAGTCAACAAATTCAAAATCAGCGACCCTGTATGTTCAGTTGTCGGTGTAGGCTTGGAGTTCCCGATGGATGTCATCTGGTCGTTTACAATGAAGTTACGATA...

Protein

Download Protein FASTA

209 aa · TkA06G033530|TK1151|PROTEIN

MSDGDVTQFTFESVHQLQLCNSLQVLGRYQEIFALPFVSGSDYAGVVESVGPTVNKFKISDPVCSVVGVGLEFPMDVIWSFTMKLRYLLQKSPSCSTFKLKKEYEVGITEYAIDDVVEKLIDRGHKTFKGINLGEWSSCVESVDDGSIAYGYAFVDYAALRFWDGSINDDASCASCVALGALLMHISPAEVLFESQGKSPFNLDLNEYL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G033530`
TK1151 ID	TkA06G033530
OH-1004 ID	LXL04_011024
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.400
Protein coverage (%)	TK1151 100.000 / OH-1004 95.853 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G033530

Location Chr06:9069059-9071559 (+)

Description Similar to MSH7: DNA mismatch repair protein MSH7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24495`	Component of the post-replicative DNA mismatch repair system (MMR).	Arabidopsis MutS homologs-AtMSH2, AtMSH3, AtMSH6, and a novel AtMSH7-form three distinct protein heterodimers with different specificities for mismatched DNA.2000 · DOI: 10.1105/tpc.12.6.991 Dissimilar mispair-recognition spectra of Arabidopsis DNA-mismatch-repair proteins MSH2MSH6 (MutSalpha) and MSH2MSH7 (MutSgamma).2003 · DOI: 10.1093/nar/gkg780

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011024 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006298 mismatch repair Biological Process

GO:0005634 nucleus Cellular Component

GO:0032301 MutSalpha complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0030983 mismatched DNA binding Molecular Function

GO:0140664 ATP-dependent DNA damage sensor activity Molecular Function

KEGG gene cross-reference

ath:AT3G24495

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.494

Rank 1 · TkA06G033530 · TK1151

Nucleus0.401

Rank 2 · TkA06G033530 · TK1151

Endoplasmic reticulum0.085

Rank 3 · TkA06G033530 · TK1151

Mitochondrion0.074

Rank 4 · TkA06G033530 · TK1151

Cell membrane0.064

Rank 5 · TkA06G033530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23495YbgU18-26 aa

PF08240ADH_N27-64 aa

PF23495YbgU101-108 aa

PF05188MutS_II145-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G033530	`PF23495`	YbgU	18	26	0.24	12.0
TkA06G033530	`PF08240`	ADH_N	27	64	2.8e-05	25.0
TkA06G033530	`PF23495`	YbgU	101	108	0.24	12.0
TkA06G033530	`PF05188`	MutS_II	145	200	0.00014	23.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMV7`	Arabidopsis thaliana	sp\|Q9SMV7\|MSH7_ARATH DNA mismatch repair protein MSH7	69.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card