TkA06G030780 | RubberDandelionOmics

Gene overview

TkA06G030780

Reference: TK1151 Chr: Chr06 Coordinates: 8355913-8356755 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

843 bp · TkA06G030780|TK1151|cDNA

ATGGGTCATTCGATAGTCAACCTTCCTAATTCCGGTGATCATACAGGAGCCACGGTTGTAGGGACGTTCAACGGGATAGTCCTTCTCGTTTTTTCTGGAACCACTGATCATATGATCCTATACAATCTGTTGACTCGAGCTTCCAAGAAAGTTCCAGATCCACCATGTCGATATAATTATCAACAAAGTAGCTATGCTTTTGGATATGGCTATGGTGCAACTACCCCAGATGACCTAAAGATTGTTAAAACTCAAGTTCA...

CDS

Download CDS FASTA

843 bp · TkA06G030780|TK1151|CDS

ATGGGTCATTCGATAGTCAACCTTCCTAATTCCGGTGATCATACAGGAGCCACGGTTGTAGGGACGTTCAACGGGATAGTCCTTCTCGTTTTTTCTGGAACCACTGATCATATGATCCTATACAATCTGTTGACTCGAGCTTCCAAGAAAGTTCCAGATCCACCATGTCGATATAATTATCAACAAAGTAGCTATGCTTTTGGATATGGCTATGGTGCAACTACCCCAGATGACCTAAAGATTGTTAAAACTCAAGTTCA...

Protein

Download Protein FASTA

280 aa · TkA06G030780|TK1151|PROTEIN

MGHSIVNLPNSGDHTGATVVGTFNGIVLLVFSGTTDHMILYNLLTRASKKVPDPPCRYNYQQSSYAFGYGYGATTPDDLKIVKTQVHSDGLWANFQEFDLKTSVWSRPQCFDPWYAYYESKCGVFLNGYLYWVANIILFLEPVIVAYNVDKKVFSRIYVPDGCEDMSKNLLGIVNGYLCMMCLEYDEYNVWVMKKGLQGVKKSWSKAYSFKIHLDSYPSCIYILDQERYLMIDSYGKFYIHDTSKKHQCEPRLILLNGDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G030780`
TK1151 ID	TkA06G030780
OH-1004 ID	LXL04_026039
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	46.400
Protein coverage (%)	TK1151 100.000 / OH-1004 78.862 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G030780`
Location	Chr06:8355913-8356755 (+)
Description	Similar to At3g16210: Putative F-box protein At3g16210
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026039` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component
KEGG gene cross-reference	ath:AT1G12870 ath:AT3G06240 ath:AT3G10240 ath:AT3G16210 ath:AT3G23880 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.615

Rank 1 · TkA06G030780 · TK1151

Nucleus0.430

Rank 2 · TkA06G030780 · TK1151

Cell membrane0.083

Rank 3 · TkA06G030780 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA06G030780 · TK1151

Lysosome / Vacuole0.048

Rank 5 · TkA06G030780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08268FBA_321-207 aa

PF07734FBA_122-274 aa

PF31103DUF880836-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G030780	`PF08268`	FBA_3	21	207	1.7e-09	37.8
TkA06G030780	`PF07734`	FBA_1	22	274	4.6e-16	59.4
TkA06G030780	`PF31103`	DUF8808	36	114	0.17	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card