TkA06G030660 | RubberDandelionOmics

Gene overview

TkA06G030660

Reference: TK1151 Chr: Chr06 Coordinates: 8308575-8316456 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3021 bp · TkA06G030660|TK1151|cDNA

ATGTCCTATGCTGACAAAGTTGGAAAGAAGAGACAGATGGCCAACCTGTTTTCAGGAAGCGAGCCATATAGTACTACAATTTATGGCTATTTTATTGAAAAACGGGTGAACTACTTCAACATGAATAAATACGCCATGAGTAAATGGAAGCAGTTTGGAATTGAGGAGGTTATGGTGAATGAAGAGGGTATTTACTTCTTCAGATTCAGTTCTGAACAAGGAGTAAAAGGTGTTCTTGAAGGCGGTCCATGGCTAGTTTT...

CDS

Download CDS FASTA

3021 bp · TkA06G030660|TK1151|CDS

ATGTCCTATGCTGACAAAGTTGGAAAGAAGAGACAGATGGCCAACCTGTTTTCAGGAAGCGAGCCATATAGTACTACAATTTATGGCTATTTTATTGAAAAACGGGTGAACTACTTCAACATGAATAAATACGCCATGAGTAAATGGAAGCAGTTTGGAATTGAGGAGGTTATGGTGAATGAAGAGGGTATTTACTTCTTCAGATTCAGTTCTGAACAAGGAGTAAAAGGTGTTCTTGAAGGCGGTCCATGGCTAGTTTT...

Protein

Download Protein FASTA

1006 aa · TkA06G030660|TK1151|PROTEIN

MSYADKVGKKRQMANLFSGSEPYSTTIYGYFIEKRVNYFNMNKYAMSKWKQFGIEEVMVNEEGIYFFRFSSEQGVKGVLEGGPWLVFDNPIIIRRWAPGLNISKAQHNVVPVWVKIFNVPLEYWNNTGINHIAWEIGKPLEADSWTANMCNSHWGRPGFMRILIEMSAEKDWLKELNVFSRDIMTGERIQAKCKIEYAWTPSKCSHCKVFGHRDSTCGILIAMDLKIKENSSKEKEAQEGRKVNLIEELLKNTVQVNPSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G030660`
TK1151 ID	TkA06G030660
OH-1004 ID	LXL04_039287
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.400
Protein coverage (%)	TK1151 79.423 / OH-1004 11.244 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G030660`
Location	Chr06:8308575-8316456 (+)
Description	Similar to LINE-1 retrotransposable element ORF2 protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039287` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0032197 retrotransposition Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:0003723 RNA binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.665

Rank 1 · TkA06G030660 · TK1151

Nucleus0.259

Rank 2 · TkA06G030660 · TK1151

Cell membrane0.179

Rank 3 · TkA06G030660 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA06G030660 · TK1151

Mitochondrion0.036

Rank 5 · TkA06G030660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14111DUF428326-101 aa

PF13966zf-RVT200-208 aa

PF04312DUF460254-274 aa

PF03372Exo_endo_phos289-322 aa

PF30198Tyr_recomb_halo_M418-462 aa

PF04312DUF460444-496 aa

PF13966zf-RVT482-493 aa

PF14111DUF4283520-537 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G030660	`PF14111`	DUF4283	26	101	1.2e-10	41.7
TkA06G030660	`PF13966`	zf-RVT	200	208	4.8e-05	24.7
TkA06G030660	`PF04312`	DUF460	254	274	0.15	12.5
TkA06G030660	`PF03372`	Exo_endo_phos	289	322	0.028	14.9
TkA06G030660	`PF30198`	Tyr_recomb_halo_M	418	462	0.18	13.1
TkA06G030660	`PF04312`	DUF460	444	496	0.15	12.5
TkA06G030660	`PF13966`	zf-RVT	482	493	4.8e-05	24.7
TkA06G030660	`PF14111`	DUF4283	520	537	1.2e-10	41.7
TkA06G030660	`PF03372`	Exo_endo_phos	524	625	0.028	14.9
TkA06G030660	`PF13966`	zf-RVT	856	895	4.8e-05	24.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card