Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1900 bp · TkA06G029700|TK1151|cDNA
TCTAACTTTTGTACAGCGAATGAGAACCGCATAAATCATGTGGAAGAAAGACAAAACTCAAGAATGAAGATACGCTTCCCAACGATCAATAGCGGGCAAAACTAATCGTTACTTGACCAATCACTAATCGCCGGAATCACTCCCGTCGCCATTGCCGTTCATCGGAATTTCTCAAACATCTTCAGCTATTGAAGTACAAAAAAACTTATCAACTACCAAATGGATCTTGGAAACAACGACTGTGAACCAAGAAAAAGTGG...
1332 bp · TkA06G029700|TK1151|CDS
ATGGATCTTGGAAACAACGACTGTGAACCAAGAAAAAGTGGATCTTTTAGTCGAATCAGCAGTACAAATTCATCATTTAGGAGACGCTCTTTCAATCGATTAGGATCAGGCATCCATGAAGCTGATAATGACAGTGATCACCAATCAGTTTCAGAGGCCGGAGATATTGGAGACAGGGCACTTCATAGTAAAAGACATAGTGGTATAAGCGAGAGTGGTGGGCCCGTTTTCCCTTTCGATAATCTTGTAATTCCAATTGA...
Protein
Download Protein FASTA443 aa · TkA06G029700|TK1151|PROTEIN
MDLGNNDCEPRKSGSFSRISSTNSSFRRRSFNRLGSGIHEADNDSDHQSVSEAGDIGDRALHSKRHSGISESGGPVFPFDNLVIPIEEHSRKESQPSSPDAILHDKGNNEECENEKELPWFMTYISSRIHLAVLGILGVLTRYLLERLFGPQVVGATSDNSYMYIDLPPNMIGSFLMGWLGTVYKKDISKFSPELAVGLTTGYLGSLTTFSGWNQKMLELSVNGHWVFSFLGFFLGLFLVAYSFIFGVETAKGAKWVFTK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G029700 |
|---|---|
| TK1151 ID | TkA06G029700 |
| OH-1004 ID | LXL04_026062 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G029700 |
|---|---|
| Location | Chr06:8042113-8045416 (+) |
| Description | Similar to fex-1: Fluoride export protein 1 (Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0140114 cellular detoxification of fluoride Biological Process GO:0140116 fluoride export across plasma membrane Biological Process GO:1903424 fluoride transmembrane transport Biological Process GO:0005886 plasma membrane Cellular Component GO:0046872 metal ion binding Molecular Function GO:0062054 fluoride channel activity Molecular Function GO:1903425 fluoride transmembrane transporter activity Molecular Function |
| KEGG gene cross-reference | gem:GM21_0714 ncr:NCU06262 spo:2543234 spo:3361186 sse:Ssed_2130 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03779SPW120-137 aaPF02537CRCB131-247 aaPF03779SPW225-256 aaPF13807GNVR278-302 aaPF03779SPW287-325 aaPF02537CRCB317-428 aaPF03779SPW388-422 aaPF03779SPW388-425 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G029700 | PF03779 | SPW | 120 | 137 | 5.3 | 8.3 |
| TkA06G029700 | PF02537 | CRCB | 131 | 247 | 2.6e-32 | 111.9 |
| TkA06G029700 | PF03779 | SPW | 225 | 256 | 5.3 | 8.3 |
| TkA06G029700 | PF13807 | GNVR | 278 | 302 | 0.26 | 11.9 |
| TkA06G029700 | PF03779 | SPW | 287 | 325 | 5.3 | 8.3 |
| TkA06G029700 | PF02537 | CRCB | 317 | 428 | 2.6e-32 | 111.9 |
| TkA06G029700 | PF03779 | SPW | 388 | 422 | 5.3 | 8.3 |
| TkA06G029700 | PF03779 | SPW | 388 | 425 | 5.3 | 8.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.