TkA06G029630 | RubberDandelionOmics

Gene overview

TkA06G029630

Reference: TK1151 Chr: Chr06 Coordinates: 8028482-8032218 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2543 bp · TkA06G029630|TK1151|cDNA

AAAACATCCTCAAATGTCTAAACCTTCCATAAATGTGTAGTTAATTCAAATTTGTTTTCATCTCTCCTTAAAAAATAAACCCCACGAAGCTCCCACTCTTCTGCACATCATGCACCAAACGCAATAGAAAATGCCAATTTGATGCTTATGGTCATGGCGGCCAGATTCAGATTTTCAATTCGGACAGGGTGGAGACATTTGACTTTCGGTATGGCTGCCTACTACGCTCAACTGCTCTGATTCTTCGATACACCACAGGA...

CDS

Download CDS FASTA

1893 bp · TkA06G029630|TK1151|CDS

ATGGGTTGGAAAAACCCATTCAAAGATATCGCGAACTCAAAGCCATTGTTCTTGACGGTTTATGGCACCGTGTTGATCGGAATCATCTTCTCTGCCATTTACGTCTTCTCCGCCGTATACACTCCCGATTCCGCCTTCTCCTGGCGCCTATCTCAGCATGCGGCACCTTCTTCCCCAAATCAAACACTCGATTCATCTCCATTAAGAGTGGGTGGCGGCGTAATGGCACCTACACCTCAGCCCCAAAAATTGAATCTAAA...

Protein

Download Protein FASTA

630 aa · TkA06G029630|TK1151|PROTEIN

MGWKNPFKDIANSKPLFLTVYGTVLIGIIFSAIYVFSAVYTPDSAFSWRLSQHAAPSSPNQTLDSSPLRVGGGVMAPTPQPQKLNLNPIWKPPPSDSKMPPLETFRLTKELVQERVKDNVIIATFGNYAFMDFILTWVKHLTDLGVENLLVGAMDTKLLEALYWKGVPVFDMGSHMSTIDVGWGSPTFHKMGREKVILIDSMLPFGYELLMCDTDMVWLKNPLPYLARYPEADVLTSTDQVTPTVSDDRLDIWQQVGGAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G029630`
TK1151 ID	TkA06G029630
OH-1004 ID	LXL04_026064
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G029630

Location Chr06:8028482-8032218 (+)

Description Similar to XEG113: Arabinosyltransferase XEG113

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35610`	Plays a role in the arabinosylation of cell wall components.	Identification of plant cell wall mutants by means of a forward chemical genetic approach using hydrolases.2009 · DOI: 10.1073/pnas.0905434106 Cell wall properties play an important role in the emergence of lateral root primordia from the parent root.2014 · DOI: 10.1093/jxb/eru056

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026064 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010306 rhamnogalacturonan II biosynthetic process Biological Process

GO:0031506 cell wall glycoprotein biosynthetic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080147 root hair cell development Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G19360

ath:AT1G56550

ath:AT1G70630

ath:AT1G75110

ath:AT2G35610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.826

Rank 1 · TkA06G029630 · TK1151

Endoplasmic reticulum0.101

Rank 2 · TkA06G029630 · TK1151

Cytoplasm0.063

Rank 3 · TkA06G029630 · TK1151

Cell membrane0.051

Rank 4 · TkA06G029630 · TK1151

Extracellular0.042

Rank 5 · TkA06G029630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03407Nucleotid_trans146-370 aa

PF10250O-FucT416-445 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G029630	`PF03407`	Nucleotid_trans	146	370	6.1e-53	180.6
TkA06G029630	`PF10250`	O-FucT	416	445	0.042	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VXZ5`	Arabidopsis thaliana	sp\|Q8VXZ5\|XG113_ARATH Arabinosyltransferase XEG113	74.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card