TkA06G028370 | RubberDandelionOmics

Gene overview

TkA06G028370

Reference: TK1151 Chr: Chr06 Coordinates: 7686023-7688344 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1563 bp · TkA06G028370|TK1151|cDNA

AAAGACTGCAACAAAGCACCCAATTTTAGTAGAGTGGTTGAAGAGTTGTTGCATTTCCTCTTTTCCCATTCATCTTCATATCAATATAATCCAATCCCAGATGATTACCACTTATACTCCACAATTAATCACAATCTCTCTCACTAATCATGAAAGACTCACCAAAAACCTGGAAACCCCACTGCTGTACAGCCGAAAACAAGGTATTTCACAGCTTCAGCCGTTGCCGACCTTCCAAATCGGAATTCTCCAAAAATGTA...

CDS

Download CDS FASTA

1260 bp · TkA06G028370|TK1151|CDS

ATGAAAGACTCACCAAAAACCTGGAAACCCCACTGCTGTACAGCCGAAAACAAGGTATTTCACAGCTTCAGCCGTTGCCGACCTTCCAAATCGGAATTCTCCAAAAATGTAGCACCGTCACCGTCGTTCCGACGCATGTCTTTCTCGGACCTTAGCAGGTCTTCTTCTATGCGTCTTAATGAAGACATTCAGAGCTTCGGGCCGGACTTGTTTGATTTTAAATTGAGCGAGCTCCGAGCTGTAACTCAGAATTTCTCGAG...

Protein

Download Protein FASTA

419 aa · TkA06G028370|TK1151|PROTEIN

MKDSPKTWKPHCCTAENKVFHSFSRCRPSKSEFSKNVAPSPSFRRMSFSDLSRSSSMRLNEDIQSFGPDLFDFKLSELRAVTQNFSSNFLLGEGGFGKVHKGYVDESMRSGLKAQPVAVKLLDIEGLQGHREWLAEVIFLGQLRHPNLVKLIGYCCEEEERLLVYEFMARGSLENHLFKRILVCLPWGIRIRIAIGAAKGLAFLHGGAESPVIYRDFKTSNILLDSDFNAKLSDFGLATMGPEGSNTHVTTRVMGTYGYA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G028370`
TK1151 ID	TkA06G028370
OH-1004 ID	LXL04_026078
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G028370

Location Chr06:7686023-7688344 (+)

Description Similar to PBL15: Probable serine/threonine-protein kinase PBL15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61590`	May be involved in plant defense signaling.	No verified direct reference in this release
`At2g05940`	Serine/threonine-protein kinase involved in disease resistance.	xopAC-triggered immunity against Xanthomonas depends on Arabidopsis receptor-like cytoplasmic kinase genes PBL2 and RIPK.2013 · DOI: 10.1371/journal.pone.0073469 Pseudomonas syringae Effector AvrPphB Suppresses AvrB-Induced Activation of RPM1 but Not AvrRpm1-Induced Activation.2015 · DOI: 10.1094/mpmi-08-14-0248-r
`At5g01020`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026078 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0012501 programmed cell death Biological Process

GO:0032491 detection of molecule of fungal origin Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process

GO:1901141 regulation of lignin biosynthetic process Biological Process

GO:1903428 positive regulation of reactive oxygen species biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G61590

ath:AT2G05940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.695

Rank 1 · TkA06G028370 · TK1151

Nucleus0.234

Rank 2 · TkA06G028370 · TK1151

Cytoplasm0.221

Rank 3 · TkA06G028370 · TK1151

Endoplasmic reticulum0.039

Rank 4 · TkA06G028370 · TK1151

Golgi apparatus0.025

Rank 5 · TkA06G028370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase90-359 aa

PF07714PK_Tyr_Ser-Thr91-363 aa

PF24192DUF7417254-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G028370	`PF00069`	Pkinase	90	359	8.5e-41	140.8
TkA06G028370	`PF07714`	PK_Tyr_Ser-Thr	91	363	3.6e-43	148.5
TkA06G028370	`PF24192`	DUF7417	254	285	0.26	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY91`	Arabidopsis thaliana	sp\|Q9SY91\|PBL15_ARATH Probable serine/threonine-protein kinase PBL15	72.900%	Swiss-Prot	High
`Q9ZUF4`	Arabidopsis thaliana	sp\|Q9ZUF4\|RIPK_ARATH Serine/threonine-protein kinase RIPK	63.400%	Swiss-Prot	High
`Q8GXZ3`	Arabidopsis thaliana	sp\|Q8GXZ3\|PBL8_ARATH Probable serine/threonine-protein kinase PBL8	63.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card