Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1148 bp · TkA06G028350|TK1151|cDNA
TGAAACACTTGTCAATTCATGAAGCTGGCAGCGAAGTGGGTACTGGATGCGATCAGAGTGCGTGACAACCCTTTTCAACGTTTCCACTAAACTCCCCCCCATTTTCTCCCTCTCTCTGCCCTCAAAATCCATCGAAGATACCTCCGTTTTTCTTATCGGTGCCATCTCCCTAGTCATGAGCCTTTTCGGTCTCGGCAGGAACCAGAGGACATTTCGTCCCAAAAAGAGTGCACCTTCTGGGAGTAAGGGGGCACAATTAA...
774 bp · TkA06G028350|TK1151|CDS
ATGCGATCAGAGTGCGTGACAACCCTTTTCAACGTTTCCACTAAACTCCCCCCCATTTTCTCCCTCTCTCTGCCCTCAAAATCCATCGAAGATACCTCCGTTTTTCTTATCGGTGCCATCTCCCTAGTCATGAGCCTTTTCGGTCTCGGCAGGAACCAGAGGACATTTCGTCCCAAAAAGAGTGCACCTTCTGGGAGTAAGGGGGCACAATTAAGGCAACACATTGATGCAACTTTGGGTAGTGGAAACCTAAGAGAAGC...
Protein
Download Protein FASTA257 aa · TkA06G028350|TK1151|PROTEIN
MRSECVTTLFNVSTKLPPIFSLSLPSKSIEDTSVFLIGAISLVMSLFGLGRNQRTFRPKKSAPSGSKGAQLRQHIDATLGSGNLREAVRLPPGEDINEWLAVNTVDFFNQVNLLYGTLTEFCTPEICPTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEFLMDWIESQLDDESIFPQRLGAPFPANFRDVVKTIFKRLFRVYAHIYHTHFQKIVSLKEEAHLNTCFKHFILFTCEFSLIDKKELAPLHELIESIVTY
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G028350 |
|---|---|
| TK1151 ID | TkA06G028350 |
| OH-1004 ID | LXL04_006234 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 95.300 |
| Protein coverage (%) | TK1151 73.930 / OH-1004 74.793Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G028350 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:7676963-7679250 (-) | |||||||||
| Description | Similar to MOB1A: MOB kinase activator-like 1A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0007165 signal transduction Biological Process GO:0008283 cell population proliferation Biological Process GO:0009553 embryo sac development Biological Process GO:0009554 megasporogenesis Biological Process GO:0009556 microsporogenesis Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0010449 root meristem growth Biological Process GO:0035265 organ growth Biological Process GO:0048229 gametophyte development Biological Process GO:0048364 root development Biological Process GO:0051301 cell division Biological Process GO:0080141 regulation of jasmonic acid biosynthetic process Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT4G19045 ath:AT5G45550 ddi:DDB_G0278907 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03637Mob1_phocein77-247 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G028350 | PF03637 | Mob1_phocein | 77 | 247 | 2.3e-80 | 269.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.