TkA06G028070 | RubberDandelionOmics

Gene overview

TkA06G028070

Reference: TK1151 Chr: Chr06 Coordinates: 7592182-7600750 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1551 bp · TkA06G028070|TK1151|cDNA

TTCACTTTTTGGAGAATTGTTCCCCTCTGTCTTCTTTAATGTTGAGTGCCCTGCACTTTTTGGATAGTTGTTCCCCGACGTATTATTTAATGGGGATTTTTCGTTCCCAATGTTTGCCGGAAATAATACCGTTTCTTCGACTTCTGTATCCTGATCCGCTTCCGATGATAGTTTATTTTCCAATTCCTCCTCTGTAGATGATTCTGGGCAATTGGAATCGTGTTCTTCCTCGTCGTCGGATTCTTCGGTTGTGTTCTCCA...

CDS

Download CDS FASTA

957 bp · TkA06G028070|TK1151|CDS

ATGAACCATAGCTGTACCCTGTTCCTTACTCCCTCCACTATCTGCTCAAAATTTGCACCCAAATTTATCGGCTTCAACACTTTGAAGATTCTCAGGAACACAAGAAAATCATCCCAAATAAGCTGCTCCGGCGCCGACAATTCTCAAAATCAACAGCAACAACTCAATCTATCCGTTCTTCGCTTCACATTAGGGATTCCTGGATTAGATGAGTCCTACTTACCCAGATGGATTGGCTACACATTTGGATCTCTTATCGT...

Protein

Download Protein FASTA

318 aa · TkA06G028070|TK1151|PROTEIN

MNHSCTLFLTPSTICSKFAPKFIGFNTLKILRNTRKSSQISCSGADNSQNQQQQLNLSVLRFTLGIPGLDESYLPRWIGYTFGSLIVLNHFVGTTSTTVTPAQLRTELLGLSLAAFSVFLPYIGQFLKGATPVIQANIPEGAEQIFAISPHISETMKEDLAWGSYTLLRNTNSVSVLISMDDVICVRGYWNTPKTIDSSKEQAVEWFKEQIQRIGLFNLKDTLYFPQRSGKLYHMIWFKRFLGIKSNLIICGQIQILSCG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G028070`
TK1151 ID	TkA06G028070
OH-1004 ID	LXL04_026086
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.200
Protein coverage (%)	TK1151 74.214 / OH-1004 85.053 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G028070

Location Chr06:7592182-7600750 (+)

Description Similar to CCB2: Protein COFACTOR ASSEMBLY OF COMPLEX C SUBUNIT B CCB2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52110`	Required for the biogenesis and accumulation of native cytochrome b6 in the thylakoid membrane.	HCF208, a homolog of Chlamydomonas CCB2, is required for accumulation of native cytochrome b6 in Arabidopsis thaliana.2007 · DOI: 10.1093/pcp/pcm146

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026086 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010190 cytochrome b6f complex assembly Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT5G52110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.945

Rank 1 · TkA06G028070 · TK1151

Nucleus0.052

Rank 2 · TkA06G028070 · TK1151

Mitochondrion0.038

Rank 3 · TkA06G028070 · TK1151

Cytoplasm0.030

Rank 4 · TkA06G028070 · TK1151

Cell membrane0.022

Rank 5 · TkA06G028070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11152CCB2_CCB474-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G028070	`PF11152`	CCB2_CCB4	74	229	1.2e-37	129.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ81`	Arabidopsis thaliana	sp\|Q9FJ81\|CCB2_ARATH Protein COFACTOR ASSEMBLY OF COMPLEX C SUBUNIT B CCB2, chloroplastic	57.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card